+ USE_DATABASE_REPLICATED=0 + USE_SHARED_CATALOG=0 ++ rg -v '#' /usr/share/zoneinfo/zone.tab ++ awk '{print $3}' ++ shuf ++ head -n1 + TZ=America/Paramaribo + echo 'Chosen random timezone America/Paramaribo' + ln -snf /usr/share/zoneinfo/America/Paramaribo /etc/localtime Chosen random timezone America/Paramaribo + echo America/Paramaribo + dpkg -i package_folder/clickhouse-common-static_24.8.14.10503.altinitytest+asan_amd64.deb Selecting previously unselected package clickhouse-common-static. (Reading database ... 48426 files and directories currently installed.) Preparing to unpack .../clickhouse-common-static_24.8.14.10503.altinitytest+asan_amd64.deb ... Unpacking clickhouse-common-static (24.8.14.10503.altinitytest+asan) ... Setting up clickhouse-common-static (24.8.14.10503.altinitytest+asan) ... + dpkg -i package_folder/clickhouse-common-static-dbg_24.8.14.10503.altinitytest+asan_amd64.deb Selecting previously unselected package clickhouse-common-static-dbg. (Reading database ... 48453 files and directories currently installed.) Preparing to unpack .../clickhouse-common-static-dbg_24.8.14.10503.altinitytest+asan_amd64.deb ... Unpacking clickhouse-common-static-dbg (24.8.14.10503.altinitytest+asan) ... Setting up clickhouse-common-static-dbg (24.8.14.10503.altinitytest+asan) ... + dpkg -i package_folder/clickhouse-odbc-bridge_24.8.14.10503.altinitytest+asan_amd64.deb Selecting previously unselected package clickhouse-odbc-bridge. (Reading database ... 48460 files and directories currently installed.) Preparing to unpack .../clickhouse-odbc-bridge_24.8.14.10503.altinitytest+asan_amd64.deb ... Unpacking clickhouse-odbc-bridge (24.8.14.10503.altinitytest+asan) ... Setting up clickhouse-odbc-bridge (24.8.14.10503.altinitytest+asan) ... + dpkg -i package_folder/clickhouse-library-bridge_24.8.14.10503.altinitytest+asan_amd64.deb Selecting previously unselected package clickhouse-library-bridge. (Reading database ... 48466 files and directories currently installed.) Preparing to unpack .../clickhouse-library-bridge_24.8.14.10503.altinitytest+asan_amd64.deb ... Unpacking clickhouse-library-bridge (24.8.14.10503.altinitytest+asan) ... Setting up clickhouse-library-bridge (24.8.14.10503.altinitytest+asan) ... + dpkg -i package_folder/clickhouse-server_24.8.14.10503.altinitytest+asan_amd64.deb Selecting previously unselected package clickhouse-server. (Reading database ... 48472 files and directories currently installed.) Preparing to unpack .../clickhouse-server_24.8.14.10503.altinitytest+asan_amd64.deb ... Unpacking clickhouse-server (24.8.14.10503.altinitytest+asan) ... Setting up clickhouse-server (24.8.14.10503.altinitytest+asan) ... ClickHouse binary is already located at /usr/bin/clickhouse Symlink /usr/bin/clickhouse-server already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-server to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-client to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-local to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-benchmark to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-obfuscator to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-git-import to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-compressor to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-format to /usr/bin/clickhouse. Symlink /usr/bin/clickhouse-extract-from-config already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-extract-from-config to /usr/bin/clickhouse. Symlink /usr/bin/clickhouse-keeper already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-keeper to /usr/bin/clickhouse. Symlink /usr/bin/clickhouse-keeper-converter already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-keeper-converter to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-disks to /usr/bin/clickhouse. Creating symlink /usr/bin/ch to /usr/bin/clickhouse. Creating symlink /usr/bin/chl to /usr/bin/clickhouse. Creating symlink /usr/bin/chc to /usr/bin/clickhouse. Creating clickhouse group if it does not exist. groupadd -r clickhouse Creating clickhouse user if it does not exist. useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse clickhouse Will set ulimits for clickhouse user in /etc/security/limits.d/clickhouse.conf. Creating config directory /etc/clickhouse-server/config.d that is used for tweaks of main server configuration. Creating config directory /etc/clickhouse-server/users.d that is used for tweaks of users configuration. Config file /etc/clickhouse-server/config.xml already exists, will keep it and extract path info from it. /etc/clickhouse-server/config.xml has /var/lib/clickhouse/ as data path. /etc/clickhouse-server/config.xml has /var/log/clickhouse-server/ as log path. Users config file /etc/clickhouse-server/users.xml already exists, will keep it and extract users info from it. Log directory /var/log/clickhouse-server/ already exists. Creating data directory /var/lib/clickhouse/. Creating pid directory /var/run/clickhouse-server. chown -R clickhouse:clickhouse '/var/log/clickhouse-server/' chown -R clickhouse:clickhouse '/var/run/clickhouse-server' chown clickhouse:clickhouse '/var/lib/clickhouse/' groupadd -r clickhouse-bridge useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse-bridge clickhouse-bridge chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-odbc-bridge' chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-library-bridge' Password for the default user is an empty string. See /etc/clickhouse-server/users.xml and /etc/clickhouse-server/users.d to change it. Setting capabilities for clickhouse binary. This is optional. chown -R clickhouse:clickhouse '/etc/clickhouse-server' ClickHouse has been successfully installed. Start clickhouse-server with: sudo clickhouse start Start clickhouse-client with: clickhouse-client + dpkg -i package_folder/clickhouse-client_24.8.14.10503.altinitytest+asan_amd64.deb Selecting previously unselected package clickhouse-client. (Reading database ... 48489 files and directories currently installed.) Preparing to unpack .../clickhouse-client_24.8.14.10503.altinitytest+asan_amd64.deb ... Unpacking clickhouse-client (24.8.14.10503.altinitytest+asan) ... Setting up clickhouse-client (24.8.14.10503.altinitytest+asan) ... + echo '' + [[ -z '' ]] + ch --query 'SELECT 1' 1 + chl --query 'SELECT 1' 1 + chc --version ClickHouse client version 24.8.14.10503.altinitytest (altinity build). + ln -s /usr/share/clickhouse-test/clickhouse-test /usr/bin/clickhouse-test + source /attach_gdb.lib ++ source /utils.lib +++ sysctl kernel.core_pattern=core.%e.%p-%P kernel.core_pattern = core.%e.%p-%P +++ sysctl fs.suid_dumpable=1 fs.suid_dumpable = 1 + source /utils.lib ++ sysctl kernel.core_pattern=core.%e.%p-%P kernel.core_pattern = core.%e.%p-%P ++ sysctl fs.suid_dumpable=1 fs.suid_dumpable = 1 + /usr/share/clickhouse-test/config/install.sh + DEST_SERVER_PATH=/etc/clickhouse-server + DEST_CLIENT_PATH=/etc/clickhouse-client +++ dirname /usr/share/clickhouse-test/config/install.sh ++ cd /usr/share/clickhouse-test/config ++ pwd -P + SRC_PATH=/usr/share/clickhouse-test/config + echo 'Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server' + mkdir -p /etc/clickhouse-server/config.d/ Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server + mkdir -p /etc/clickhouse-server/users.d/ + mkdir -p /etc/clickhouse-client + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_write.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/max_num_to_warn.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/listen.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/text_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/blob_storage_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/custom_settings_prefixes.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/database_catalog_drop_table_concurrency.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_access_control_improvements.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/macros.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/secure_ports.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/clusters.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/graphite.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/graphite_alternative.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/grpc_protocol.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/database_atomic.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/max_concurrent_queries.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_settings.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/backoff_failed_mutation.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_old_dirs_cleanup.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/test_cluster_with_incorrect_pw.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/keeper_port.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/logging_no_rotate.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/lost_forever_check.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/tcp_with_proxy.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/prometheus.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_lists.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/transactions.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/encryption.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/CORS.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/logger_trace.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/named_collection.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/ssl_certs.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_cache_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/session_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/system_unfreeze.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_zero_copy_replication.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/nlp.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/forbidden_headers.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_keeper_map.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/custom_disks_base_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/display_name.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/compressed_marks_and_index.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/disable_s3_env_credentials.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_wait_for_shutdown_replicated_tables.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/backups.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_caches_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/validate_tcp_client_information.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/zero_copy_destructive_operations.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/block_number.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/handlers.yaml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/serverwide_trace_collector.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/rocksdb.xml /etc/clickhouse-server/config.d/ + '[' /etc/clickhouse-server = /etc/clickhouse-server ']' + ln -sf /usr/share/clickhouse-test/config/config.d/legacy_geobase.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/log_queries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/readonly.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/access_management.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/database_atomic_drop_detach_sync.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/opentelemetry.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/remote_queries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/session_log_test.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/memory_profiler.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/no_fsync_metadata.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/filelog.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/enable_blobs_check.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/marks.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/insert_keeper_retries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/prefetch_settings.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/nonconst_timezone.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/allow_introspection_functions.yaml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/replicated_ddl_entry.xml /etc/clickhouse-server/users.d/ + [[ -n '' ]] + ln -sf /usr/share/clickhouse-test/config/users.d/timeouts.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/ints_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/strings_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/decimals_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/executable_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/executable_pool_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/test_function.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/top_level_domains /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/regions_hierarchy.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/regions_names_en.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/ext-en.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/ext-ru.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/lem-en.bin /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/server.key /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/server.crt /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/dhparam.pem /etc/clickhouse-server/ + ln -sf --backup=simple --suffix=_original.xml /usr/share/clickhouse-test/config/config.d/query_masking_rules.xml /etc/clickhouse-server/config.d/ + [[ -n '' ]] + rm -f /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper.xml /etc/clickhouse-server/config.d/ + [[ -n '' ]] + rm -f /etc/clickhouse-server/config.d/cannot_allocate_thread_injection.xml + value=1 + sed --follow-symlinks -i 's|[01]|1|' /etc/clickhouse-server/config.d/keeper_port.xml + value=12404736 + sed --follow-symlinks -i 's|[[:digit:]]\+|12404736|' /etc/clickhouse-server/config.d/keeper_port.xml + value=18819072 + sed --follow-symlinks -i 's|[[:digit:]]\+|18819072|' /etc/clickhouse-server/config.d/keeper_port.xml + [[ -n '' ]] + [[ -n '' ]] + [[ '' == \1 ]] + [[ '' == \1 ]] + [[ -n 1 ]] + ln -sf /usr/share/clickhouse-test/config/config.d/azure_storage_conf.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02944.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02963.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02961.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache_new.xml /etc/clickhouse-server/users.d/ + [[ -n 0 ]] + [[ 0 -eq 1 ]] + ln -sf /usr/share/clickhouse-test/config/client_config.xml /etc/clickhouse-client/config.xml + [[ -n 0 ]] + [[ 0 -eq 1 ]] + ./setup_minio.sh stateless + azurite-blob --blobHost 0.0.0.0 --blobPort 10000 --debug /azurite_log + export MINIO_ROOT_USER=clickhouse + MINIO_ROOT_USER=clickhouse + export MINIO_ROOT_PASSWORD=clickhouse + MINIO_ROOT_PASSWORD=clickhouse + main stateless + local query_dir ++ check_arg stateless ++ local query_dir ++ '[' '!' 1 -eq 1 ']' ++ case "$1" in ++ query_dir=0_stateless ++ echo 0_stateless + query_dir=0_stateless + '[' '!' -f ./minio ']' + start_minio + mkdir -p ./minio_data + ./minio --version minio version RELEASE.2024-08-03T04-33-23Z (commit-id=6efb56851c40da88d1ca15112e2d686a4ecec6b3) Runtime: go1.22.5 linux/amd64 License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html Copyright: 2015-2024 MinIO, Inc. + wait_for_it + local counter=0 + local max_counter=60 + ./minio server --address :11111 ./minio_data + local url=http://localhost:11111 + params=('--silent' '--verbose') + local params + curl --silent --verbose http://localhost:11111 + grep AccessDenied + [[ 0 == \6\0 ]] + echo 'trying to connect to minio' + sleep 1 trying to connect to minio Azurite Blob service is starting on 0.0.0.0:10000 Azurite Blob service successfully listens on http://0.0.0.0:10000 INFO: Formatting 1st pool, 1 set(s), 1 drives per set. INFO: WARNING: Host local has more than 0 drives of set. A host failure will result in data becoming unavailable. MinIO Object Storage Server Copyright: 2015-2025 MinIO, Inc. License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/amd64) API: http://172.17.0.2:11111 http://127.0.0.1:11111 WebUI: http://172.17.0.2:38413 http://127.0.0.1:38413 Docs: https://min.io/docs/minio/linux/index.html + counter=1 + curl --silent --verbose http://localhost:11111 + grep AccessDenied AccessDeniedAccess Denied./186CDA681069EEC27dc7eb22d3288ec80374614e9088e31d3668a6922ead55932dd2a8e56373820f + lsof -i :11111 COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME minio 286 root 8u IPv4 33423 0t0 TCP localhost:11111 (LISTEN) minio 286 root 9u IPv6 33424 0t0 TCP *:11111 (LISTEN) minio 286 root 10u IPv6 33425 0t0 TCP localhost:11111 (LISTEN) + sleep 5 + setup_minio stateless + local test_type=stateless + ./mc alias set clickminio http://localhost:11111 clickhouse clickhouse Added `clickminio` successfully. + ./mc admin user add clickminio test testtest Added user `test` successfully. + ./mc admin policy attach clickminio readwrite --user=test Attached Policies: [readwrite] To User: test + ./mc mb --ignore-existing clickminio/test Bucket created successfully `clickminio/test`. + '[' stateless = stateless ']' + ./mc anonymous set public clickminio/test Access permission for `clickminio/test` is set to `public` + upload_data 0_stateless /usr/share/clickhouse-test + local query_dir=0_stateless + local test_path=/usr/share/clickhouse-test + local data_path=/usr/share/clickhouse-test/queries/0_stateless/data_minio + '[' -d /usr/share/clickhouse-test/queries/0_stateless/data_minio ']' + ./mc cp --recursive /usr/share/clickhouse-test/queries/0_stateless/data_minio/ clickminio/test/ `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.parquet` -> `clickminio/test/02731.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.tar` -> `clickminio/test/03036_archive1.tar` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02366_data.jsonl` -> `clickminio/test/02366_data.jsonl` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02876.parquet` -> `clickminio/test/02876.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.arrow` -> `clickminio/test/02731.arrow` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.zip` -> `clickminio/test/03036_archive1.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.tar` -> `clickminio/test/03036_archive2.tar` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.zip` -> `clickminio/test/03036_archive2.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive3.tar.gz` -> `clickminio/test/03036_archive3.tar.gz` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_compressed_file_archive.zip` -> `clickminio/test/03036_compressed_file_archive.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/b.tsv` -> `clickminio/test/b.tsv` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_json_archive.zip` -> `clickminio/test/03036_json_archive.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/c.tsv` -> `clickminio/test/c.tsv` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/a.tsv` -> `clickminio/test/a.tsv` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/non_existing_column=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/non_existing_column=Elizabeth/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/json_data` -> `clickminio/test/json_data` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/tsv_with_header.tsv` -> `clickminio/test/tsv_with_header.tsv` Total: 5.42 MiB, Transferred: 5.42 MiB, Speed: 167.58 MiB/s + setup_aws_credentials + local minio_root_user=clickhouse + local minio_root_password=clickhouse + mkdir -p /root/.aws + cat + ./setup_hdfs_minicluster.sh + ls -lha total 125M drwxr-xr-x 1 root root 4.0K Oct 9 11:54 . drwxr-xr-x 1 root root 4.0K Oct 9 11:54 .. -rw-rw-r-- 1 1000 1000 119 Oct 9 11:51 analyzer_tech_debt.txt -rw-rw-r-- 1 root root 2.4K Jan 31 2025 attach_gdb.lib -rw-r--r-- 1 root root 1.3K Oct 9 11:54 __azurite_db_blob_extent__.json -rw-r--r-- 1 root root 3.9K Oct 9 11:54 __azurite_db_blob__.json -rw-r--r-- 1 root root 1.4K Oct 9 11:54 azurite_log lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin drwxr-xr-x 2 root root 4.0K Oct 9 11:54 __blobstorage__ drwxr-xr-x 2 root root 4.0K Apr 18 2022 boot -rw-rw-r-- 1 1000 1000 292 Oct 9 11:51 broken_tests.json drwxr-xr-x 14 root root 3.8K Oct 9 11:54 dev -rwxr-xr-x 1 root root 0 Oct 9 11:54 .dockerenv drwxr-xr-x 1 root root 4.0K Oct 9 11:54 etc drwxr-xr-x 10 1000 1000 4.0K Jun 15 2021 hadoop-3.3.1 drwxr-xr-x 2 root root 4.0K Apr 18 2022 home lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32 lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64 lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32 -rwxr-xr-x 1 root root 26M Jan 31 2025 mc drwxr-xr-x 2 root root 4.0K Sep 11 2024 media -rwxr-xr-x 1 root root 99M Jan 31 2025 minio drwxr-xr-x 4 root root 4.0K Oct 9 11:55 minio_data drwxr-xr-x 2 root root 4.0K Sep 11 2024 mnt drwxr-xr-x 1 root root 4.0K Jan 31 2025 opt -rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate drwxrwxr-x 2 1000 1000 4.0K Oct 9 11:54 package_folder dr-xr-xr-x 311 root root 0 Oct 9 11:54 proc -rwxrwxr-x 1 root root 9.5K Jan 31 2025 process_functional_tests_result.py -rw-rw-r-- 1 root root 837 Jan 31 2025 requirements.txt drwx------ 1 root root 4.0K Oct 9 11:55 root drwxr-xr-x 1 root root 4.0K Oct 9 11:54 run -rwxrwxr-x 1 root root 22K Jan 31 2025 run.sh lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin -rwxrwxr-x 1 root root 11K Jan 31 2025 setup_export_logs.sh -rwxrwxr-x 1 root root 360 Jan 31 2025 setup_hdfs_minicluster.sh -rwxrwxr-x 1 root root 3.4K Jan 31 2025 setup_minio.sh drwxr-xr-x 2 root root 4.0K Sep 11 2024 srv -rw-rw-r-- 1 root root 14K Jan 31 2025 stress_tests.lib dr-xr-xr-x 13 root root 0 Oct 9 11:54 sys drwxrwxr-x 2 1000 1000 4.0K Oct 9 11:54 test_output drwxrwxrwt 1 root root 4.0K Jan 31 2025 tmp drwxr-xr-x 1 root root 4.0K Sep 11 2024 usr -rw-rw-r-- 1 root root 897 Jan 31 2025 utils.lib drwxr-xr-x 1 root root 4.0K Sep 11 2024 var + cd hadoop-3.3.1 + export JAVA_HOME=/usr + JAVA_HOME=/usr + mkdir -p target/test/data + chown clickhouse ./target/test/data + nc -z localhost 12222 + sudo -E -u clickhouse bin/mapred minicluster -format -nomr -nnport 12222 + sleep 1 + nc -z localhost 12222 + sleep 1 + nc -z localhost 12222 + lsof -i :12222 COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME java 419 clickhouse 322u IPv4 24480 0t0 TCP localhost:12222 (LISTEN) + sleep 5 + config_logs_export_cluster /etc/clickhouse-server/config.d/system_logs_export.yaml + set +x File /tmp/export-logs-config.sh does not exist, do not setup + [[ -n '' ]] + export IS_FLAKY_CHECK=0 + IS_FLAKY_CHECK=0 + '[' 1 -gt 1 ']' + sudo -E -u clickhouse /usr/bin/clickhouse-server --config /etc/clickhouse-server/config.xml --daemon --pid-file /var/run/clickhouse-server/clickhouse-server.pid + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for _ in {1..100} + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + sleep 1 + for _ in {1..100} + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + sleep 1 127.0.0.1 - - [09/Oct/2025:14:55:09 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 404 - 127.0.0.1 - - [09/Oct/2025:14:55:09 +0000] "PUT /devstoreaccount1/cont?restype=container HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:14:55:09 +0000] "PUT /devstoreaccount1/cont/ltcekaakvqlwlzxkjblnhsabsbspjczr HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:14:55:09 +0000] "GET /devstoreaccount1/cont/ltcekaakvqlwlzxkjblnhsabsbspjczr HTTP/1.1" 206 4 127.0.0.1 - - [09/Oct/2025:14:55:09 +0000] "GET /devstoreaccount1/cont/ltcekaakvqlwlzxkjblnhsabsbspjczr HTTP/1.1" 206 2 127.0.0.1 - - [09/Oct/2025:14:55:09 +0000] "DELETE /devstoreaccount1/cont/ltcekaakvqlwlzxkjblnhsabsbspjczr HTTP/1.1" 202 - + for _ in {1..100} + clickhouse-client --query 'SELECT 1' 1 + break + setup_logs_replication + set +x File /tmp/export-logs-config.sh does not exist, do not setup + attach_gdb_to_clickhouse ++ run_with_retry 5 clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ [[ ahxB =~ e ]] ++ set_e=false ++ set +e ++ local total_retries=5 ++ shift ++ local retry=0 ++ '[' 0 -ge 5 ']' ++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ false ++ return + IS_ASAN=1 + [[ 1 = \1 ]] + echo 'ASAN build detected. Not using gdb since it disables LeakSanitizer detections' ASAN build detected. Not using gdb since it disables LeakSanitizer detections + clickhouse-client --query 'CREATE TABLE minio_audit_logs ( log String, event_time DateTime64(9) MATERIALIZED parseDateTime64BestEffortOrZero(trim(BOTH '\''"'\'' FROM JSONExtractRaw(log, '\''time'\'')), 9, '\''UTC'\'') ) ENGINE = MergeTree ORDER BY tuple()' + clickhouse-client --query 'CREATE TABLE minio_server_logs ( log String, event_time DateTime64(9) MATERIALIZED parseDateTime64BestEffortOrZero(trim(BOTH '\''"'\'' FROM JSONExtractRaw(log, '\''time'\'')), 9, '\''UTC'\'') ) ENGINE = MergeTree ORDER BY tuple()' + ./mc admin config set clickminio logger_webhook:ch_server_webhook 'endpoint=http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_server_logs%20FORMAT%20LineAsString' queue_size=1000000 batch_size=500 Successfully applied new settings. + ./mc admin config set clickminio audit_webhook:ch_audit_webhook 'endpoint=http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString' queue_size=1000000 batch_size=500 Successfully applied new settings. clickminio restart attempt 1: + max_retries=100 + retry=1 + '[' 1 -le 100 ']' + echo 'clickminio restart attempt 1:' ++ ./mc admin service restart clickminio --wait --json ++ jq -r .status INFO: Restarting on service signal MinIO Object Storage Server Copyright: 2015-2025 MinIO, Inc. License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/amd64) API: http://172.17.0.2:11111 http://127.0.0.1:11111 WebUI: http://172.17.0.2:33731 http://127.0.0.1:33731 Docs: https://min.io/docs/minio/linux/index.html Output of restart status: success success Restarted clickminio successfully. + output='success success' + echo 'Output of restart status: success success' + expected_output='success success' + '[' 'success success' = 'success success' ']' + echo 'Restarted clickminio successfully.' + break + '[' 1 -gt 100 ']' + MC_ADMIN_PID=1459 + ./mc admin trace clickminio + export -f run_tests + '[' 1 -gt 1 ']' + run_tests + set -x + read -ra ADDITIONAL_OPTIONS + HIGH_LEVEL_COVERAGE=YES + '[' 1 -gt 1 ']' + [[ -n '' ]] + [[ -n '' ]] + [[ 0 -eq 1 ]] + [[ '' -eq 1 ]] + [[ 0 -eq 1 ]] ++ clickhouse-client --query 'SELECT value LIKE '\''%SANITIZE_COVERAGE%'\'' FROM system.build_options WHERE name = '\''CXX_FLAGS'\''' + [[ 1 == 0 ]] + ADDITIONAL_OPTIONS+=('--jobs') + ADDITIONAL_OPTIONS+=('8') + [[ -n 0 ]] + [[ -n 2 ]] + ADDITIONAL_OPTIONS+=('--run-by-hash-num') + ADDITIONAL_OPTIONS+=("$RUN_BY_HASH_NUM") + ADDITIONAL_OPTIONS+=('--run-by-hash-total') + ADDITIONAL_OPTIONS+=("$RUN_BY_HASH_TOTAL") + HIGH_LEVEL_COVERAGE=NO + [[ -n '' ]] + [[ NO = \Y\E\S ]] + ADDITIONAL_OPTIONS+=('--report-logs-stats') + try_run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')' + local total_retries=10 + shift + fn_exists run_with_retry + declare -F run_with_retry + run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')' + [[ aehxB =~ e ]] + set_e=true + set +e + local total_retries=10 + shift + local retry=0 + '[' 0 -ge 10 ']' + clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')' + true + set -e + return + set +e + TEST_ARGS=(--testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --no-drop-if-fail --capture-client-stacktrace --test-runs "$NUM_TRIES" "${ADDITIONAL_OPTIONS[@]}") + clickhouse-test --testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --no-drop-if-fail --capture-client-stacktrace --test-runs 1 --hung-check --print-time --jobs 8 --run-by-hash-num 0 --run-by-hash-total 2 --report-logs-stats + ts '%Y-%m-%d %H:%M:%S' + tee -a test_output/test_result.txt 2025-10-09 11:55:12 Using queries from '/usr/share/clickhouse-test/queries' directory 2025-10-09 11:55:12 Connecting to ClickHouse server... OK 2025-10-09 11:55:12 Connected to server 24.8.14.10503.altinitytest @ e905d7433e089be5ae0e2e1a62b31c75230e5cf9 HEAD 2025-10-09 11:55:12 Found 3250 parallel tests and 281 sequential tests 2025-10-09 11:55:12 Running about 406 stateless tests (Process-7). 2025-10-09 11:55:12 02581_share_big_sets_between_mutation_tasks: [ SKIPPED ] 0.00 sec. 2025-10-09 11:55:12 Reason: not running for current build 2025-10-09 11:55:13 Running about 406 stateless tests (Process-3). 2025-10-09 11:55:13 01623_byte_size_const: [ OK ] 0.57 sec. 2025-10-09 11:55:13 Running about 406 stateless tests (Process-9). 2025-10-09 11:55:13 01780_range_msan: [ OK ] 0.58 sec. 2025-10-09 11:55:13 Running about 406 stateless tests (Process-4). 2025-10-09 11:55:13 02009_array_join_partition: [ OK ] 0.62 sec. 2025-10-09 11:55:13 Running about 406 stateless tests (Process-10). 2025-10-09 11:55:13 02515_projections_with_totals: [ OK ] 0.68 sec. 2025-10-09 11:55:13 01660_second_extremes_bug: [ OK ] 0.68 sec. 2025-10-09 11:55:13 Running about 406 stateless tests (Process-5). 2025-10-09 11:55:13 01272_totals_and_filter_bug: [ OK ] 0.73 sec. 2025-10-09 11:55:14 01710_minmax_count_projection_constant_query: [ OK ] 0.57 sec. 2025-10-09 11:55:14 00370_duplicate_columns_in_subqueries: [ OK ] 0.62 sec. 2025-10-09 11:55:14 Running about 406 stateless tests (Process-6). 2025-10-09 11:55:14 01599_multiline_input_and_singleline_comments: [ OK ] 1.28 sec. 2025-10-09 11:55:14 01259_dictionary_custom_settings_ddl: [ OK ] 0.62 sec. 2025-10-09 11:55:14 02129_add_column_add_ttl: [ OK ] 0.82 sec. 2025-10-09 11:55:14 02294_dictionaries_hierarchical_index: [ OK ] 0.72 sec. 2025-10-09 11:55:14 03120_analyzer_param_in_CTE_alias: [ OK ] 0.57 sec. 2025-10-09 11:55:14 02150_replace_regexp_all_empty_match: [ OK ] 0.52 sec. 2025-10-09 11:55:14 01250_fixed_string_comparison: [ OK ] 0.57 sec. 2025-10-09 11:55:14 00448_to_string_cut_to_zero: [ OK ] 0.52 sec. 2025-10-09 11:55:14 00715_bounding_ratio_merge_empty: [ OK ] 0.52 sec. 2025-10-09 11:55:14 Running about 406 stateless tests (Process-8). 2025-10-09 11:55:14 01894_jit_aggregation_function_max_long: [ OK ] 1.98 sec. 2025-10-09 11:55:15 00688_aggregation_retention: [ OK ] 0.62 sec. 2025-10-09 11:55:15 00098_6_union_all: [ OK ] 0.52 sec. 2025-10-09 11:55:15 00437_nulls_first_last: [ OK ] 0.97 sec. 2025-10-09 11:55:16 00661_array_has_silviucpp: [ OK ] 0.52 sec. 2025-10-09 11:55:16 01580_column_const_comparision: [ OK ] 0.52 sec. 2025-10-09 11:55:16 03019_numbers_pretty: [ OK ] 0.52 sec. 2025-10-09 11:55:16 00052_all_left_join: [ OK ] 0.47 sec. 2025-10-09 11:55:16 03204_format_join_on: [ OK ] 1.87 sec. 2025-10-09 11:55:17 01280_null_in: [ OK ] 0.77 sec. 2025-10-09 11:55:17 00700_decimal_arithm: [ OK ] 2.38 sec. 2025-10-09 11:55:17 02989_replicated_merge_tree_invalid_metadata_version: [ OK ] 1.08 sec. 2025-10-09 11:55:17 00569_parse_date_time_best_effort: [ OK ] 0.52 sec. 2025-10-09 11:55:17 03208_array_of_json_read_subcolumns_2_compact_merge_tree: [ SKIPPED ] 0.00 sec. 2025-10-09 11:55:17 Reason: not running for current build 2025-10-09 11:55:17 01845_add_testcase_for_arrayElement: [ OK ] 0.62 sec. 2025-10-09 11:55:18 02788_current_schemas_function: [ OK ] 0.67 sec. 2025-10-09 11:55:18 02902_topKGeneric_deserialization_memory: [ OK ] 0.58 sec. 2025-10-09 11:55:20 00458_merge_type_cast: [ OK ] 1.44 sec. 2025-10-09 11:55:20 02361_fsync_profile_events: [ OK ] 4.08 sec. 2025-10-09 11:55:20 01950_kill_large_group_by_query: [ OK ] 3.93 sec. 2025-10-09 11:55:21 02481_pk_analysis_with_enum_to_string: [ OK ] 0.93 sec. 2025-10-09 11:55:21 01921_test_progress_bar: [ OK ] 0.52 sec. 2025-10-09 11:55:21 02533_generate_random_schema_inference: [ OK ] 0.67 sec. 2025-10-09 11:55:22 01182_materialized_view_different_structure: [ OK ] 1.83 sec. 2025-10-09 11:55:23 02366_kql_tabular: [ OK ] 1.17 sec. 2025-10-09 11:55:23 02570_fallback_from_async_insert: [ OK ] 5.64 sec. 2025-10-09 11:55:23 01186_conversion_to_nullable: [ OK ] 0.67 sec. 2025-10-09 11:55:23 01527_bad_aggregation_in_lambda: [ OK ] 0.52 sec. 2025-10-09 11:55:23 02896_max_execution_time_with_break_overflow_mode: [ OK ] 5.53 sec. 2025-10-09 11:55:25 00909_kill_not_initialized_query: [ OK ] 10.85 sec. 2025-10-09 11:55:25 01273_arrow_dictionaries_load: [ OK ] 11.50 sec. 2025-10-09 11:55:26 02842_table_function_file_filter_by_virtual_columns: [ OK ] 2.23 sec. 2025-10-09 11:55:26 02158_proportions_ztest_cmp: [ OK ] 2.68 sec. 2025-10-09 11:55:26 00299_stripe_log_multiple_inserts: [ OK ] 0.77 sec. 2025-10-09 11:55:26 01559_misplaced_codec_diagnostics: [ OK ] 0.47 sec. 2025-10-09 11:55:27 01225_drop_dictionary_as_table: [ OK ] 0.62 sec. 2025-10-09 11:55:27 00685_output_format_json_escape_forward_slashes: [ OK ] 0.58 sec. 2025-10-09 11:55:27 02124_encrypt_decrypt_nullable: [ OK ] 0.67 sec. 2025-10-09 11:55:27 02841_parallel_replicas_summary: [ OK ] 3.83 sec. 2025-10-09 11:55:28 02895_peak_memory_usage_http_headers_regression: [ OK ] 2.08 sec. 2025-10-09 11:55:28 00942_mv_rename_table: [ OK ] 0.68 sec. 2025-10-09 11:55:28 00627_recursive_alias: [ OK ] 0.57 sec. 2025-10-09 11:55:29 00313_const_totals_extremes: [ OK ] 1.63 sec. 2025-10-09 11:55:29 01681_bloom_filter_nullable_column: [ OK ] 0.92 sec. 2025-10-09 11:55:29 02766_prql: [ OK ] 2.33 sec. 2025-10-09 11:55:29 00726_length_aliases: [ OK ] 0.57 sec. 2025-10-09 11:55:30 00875_join_right_nulls: [ OK ] 0.83 sec. 2025-10-09 11:55:30 02784_parallel_replicas_automatic_decision: [ OK ] 17.22 sec. 2025-10-09 11:55:31 01802_toDateTime64_large_values: [ OK ] 0.52 sec. 2025-10-09 11:55:32 01084_regexp_empty: [ OK ] 0.57 sec. 2025-10-09 11:55:32 03262_test_parquet_native_reader_int_logical_type: [ OK ] 2.73 sec. 2025-10-09 11:55:32 01019_materialized_view_select_extra_columns: [ OK ] 0.62 sec. 2025-10-09 11:55:33 02582_analyzer_join_subquery_empty_column_list: [ OK ] 0.67 sec. 2025-10-09 11:55:33 01220_scalar_optimization_in_alter: [ OK ] 0.57 sec. 2025-10-09 11:55:34 03144_fuzz_quoted_type_name: [ OK ] 0.62 sec. 2025-10-09 11:55:34 01176_mysql_client_interactive: [ OK ] 2.43 sec. 2025-10-09 11:55:35 03203_client_benchmark_options: [ OK ] 9.15 sec. 2025-10-09 11:55:35 02534_parquet_fixed_binary_array: [ OK ] 5.53 sec. 2025-10-09 11:55:35 01354_tuple_low_cardinality_array_mapped_bug: [ OK ] 0.57 sec. 2025-10-09 11:55:35 01135_default_and_alter_zookeeper: [ OK ] 0.62 sec. 2025-10-09 11:55:35 01096_block_serialized_state: [ OK ] 0.52 sec. 2025-10-09 11:55:35 01211_optimize_skip_unused_shards_type_mismatch: [ OK ] 0.72 sec. 2025-10-09 11:55:36 01402_cast_nullable_string_to_enum: [ OK ] 0.77 sec. 2025-10-09 11:55:36 02294_optimize_aggregation_in_order_prefix_Array_functions: [ OK ] 0.57 sec. 2025-10-09 11:55:36 03143_join_filter_push_down_filled_join_fix: [ OK ] 0.62 sec. 2025-10-09 11:55:37 02025_storage_filelog_virtual_col: [ OK ] 7.64 sec. 2025-10-09 11:55:37 03057_analyzer_subquery_alias_join: [ OK ] 0.62 sec. 2025-10-09 11:55:37 02731_replace_partition_from_temporary_table: [ OK ] 1.93 sec. 2025-10-09 11:55:37 01603_decimal_mult_float: [ OK ] 0.87 sec. 2025-10-09 11:55:38 02457_parse_date_time_best_effort: [ OK ] 0.87 sec. 2025-10-09 11:55:39 02244_make_datetime: [ OK ] 0.87 sec. 2025-10-09 11:55:40 02987_group_array_intersect: [ OK ] 2.58 sec. 2025-10-09 11:55:40 00936_substring_utf8_non_const: [ OK ] 5.13 sec. 2025-10-09 11:55:40 00996_limit_with_ties: [ OK ] 1.07 sec. 2025-10-09 11:55:40 01509_format_raw_blob: [ OK ] 3.48 sec. 2025-10-09 11:55:40 02003_memory_limit_in_client: [ OK ] 10.50 sec. 2025-10-09 11:55:40 02918_parallel_replicas_custom_key_unavailable_replica: [ OK ] 0.78 sec. 2025-10-09 11:55:41 00028_shard_big_agg_aj_distributed: [ OK ] 0.67 sec. 2025-10-09 11:55:41 02901_analyzer_recursive_window: [ OK ] 0.57 sec. 2025-10-09 11:55:41 02994_inconsistent_formatting: [ OK ] 0.57 sec. 2025-10-09 11:55:41 02340_union_header: [ OK ] 0.57 sec. 2025-10-09 11:55:41 01532_having_with_totals: [ OK ] 0.82 sec. 2025-10-09 11:55:41 02896_optimize_array_exists_to_has_with_date: [ OK ] 0.52 sec. 2025-10-09 11:55:42 00720_with_cube: [ OK ] 0.72 sec. 2025-10-09 11:55:42 00700_decimal_math: [ OK ] 0.87 sec. 2025-10-09 11:55:43 00369_int_div_of_float: [ OK ] 0.58 sec. 2025-10-09 11:55:43 00278_insert_already_sorted: [ OK ] 1.18 sec. 2025-10-09 11:55:43 03208_array_of_json_read_subcolumns_2_memory: [ SKIPPED ] 0.00 sec. 2025-10-09 11:55:43 Reason: not running for current build 2025-10-09 11:55:44 02943_tokenbf_and_ngrambf_indexes_support_match_function: [ OK ] 1.03 sec. 2025-10-09 11:55:44 00252_shard_global_in_aggregate_function: [ OK ] 0.93 sec. 2025-10-09 11:55:45 02705_grouping_keys_equal_keys: [ OK ] 0.58 sec. 2025-10-09 11:55:45 02185_arraySlice_negative_offset_size: [ OK ] 0.62 sec. 2025-10-09 11:55:45 02581_share_big_sets_between_mutation_tasks_with_storage_set: [ OK ] 3.98 sec. 2025-10-09 11:55:45 01739_index_hint: [ OK ] 1.07 sec. 2025-10-09 11:55:46 02167_format_from_file_extension: [ OK ] 23.18 sec. 2025-10-09 11:55:46 02678_explain_pipeline_graph_with_projection: [ OK ] 0.58 sec. 2025-10-09 11:55:46 01354_order_by_tuple_collate_const: [ OK ] 0.57 sec. 2025-10-09 11:55:46 00003_reinterpret_as_string: [ OK ] 0.57 sec. 2025-10-09 11:55:47 01506_buffer_table_alter_block_structure: [ OK ] 0.67 sec. 2025-10-09 11:55:47 02174_cte_scalar_cache_mv: [ OK ] 6.24 sec. 2025-10-09 11:55:48 01666_gcd_ubsan: [ OK ] 0.87 sec. 2025-10-09 11:55:48 03222_json_squashing: [ OK ] 2.64 sec. 2025-10-09 11:55:48 03033_analyzer_resolve_from_parent_scope: [ OK ] 0.82 sec. 2025-10-09 11:55:48 01783_parallel_formatting_memory: [ OK ] 1.88 sec. 2025-10-09 11:55:48 02933_compare_with_bool_as_string: [ OK ] 0.52 sec. 2025-10-09 11:55:49 01256_misspell_layout_name_podshumok: [ OK ] 0.52 sec. 2025-10-09 11:55:49 01665_substring_ubsan: [ OK ] 0.52 sec. 2025-10-09 11:55:49 00848_join_use_nulls_segfault: [ OK ] 1.17 sec. 2025-10-09 11:55:49 01303_polygons_equals: [ OK ] 0.53 sec. 2025-10-09 11:55:50 01664_array_slice_ubsan: [ OK ] 0.57 sec. 2025-10-09 11:55:50 02833_tuple_concat: [ OK ] 0.82 sec. 2025-10-09 11:55:50 01825_new_type_json_18: [ OK ] 0.57 sec. 2025-10-09 11:55:50 02346_into_outfile_and_stdout: [ OK ] 5.19 sec. 2025-10-09 11:55:51 02861_interpolate_alias_precedence: [ OK ] 0.52 sec. 2025-10-09 11:55:51 01113_local_dictionary_type_conversion: [ OK ] 0.57 sec. 2025-10-09 11:55:51 01499_json_named_tuples: [ OK ] 0.57 sec. 2025-10-09 11:55:51 01548_with_totals_having: [ OK ] 0.67 sec. 2025-10-09 11:55:52 00460_vertical_and_totals_extremes: [ OK ] 0.57 sec. 2025-10-09 11:55:52 02890_untuple_column_names: [ OK ] 0.77 sec. 2025-10-09 11:55:52 01051_aggregate_function_crash: [ OK ] 0.52 sec. 2025-10-09 11:55:52 00471_sql_style_quoting: [ OK ] 0.52 sec. 2025-10-09 11:55:53 02503_join_switch_alias_fuzz: [ OK ] 0.52 sec. 2025-10-09 11:55:54 01523_interval_operator_support_string_literal: [ OK ] 0.72 sec. 2025-10-09 11:55:54 03198_settings_in_csv_tsv_schema_cache: [ OK ] 2.83 sec. 2025-10-09 11:55:55 01560_crash_in_agg_empty_arglist: [ OK ] 1.12 sec. 2025-10-09 11:55:55 02874_json_merge_patch_function_test: [ OK ] 0.77 sec. 2025-10-09 11:55:56 01825_type_json_field: [ OK ] 0.82 sec. 2025-10-09 11:55:57 02366_kql_mvexpand: [ OK ] 0.87 sec. 2025-10-09 11:55:57 02521_incorrect_dealy_for_insert_bug_44902: [ OK ] 16.71 sec. 2025-10-09 11:55:57 03207_json_read_subcolumns_1_wide_merge_tree: [ OK ] 5.14 sec. 2025-10-09 11:55:58 03037_dot_product_overflow: [ OK ] 0.52 sec. 2025-10-09 11:55:58 01710_normal_projection_join_plan_fix: [ OK ] 0.62 sec. 2025-10-09 11:55:58 02124_insert_deduplication_token_replica: [ OK ] 1.07 sec. 2025-10-09 11:55:58 02890_describe_table_options: [ OK ] 0.72 sec. 2025-10-09 11:55:59 02293_h3_hex_ring: [ OK ] 0.87 sec. 2025-10-09 11:56:00 02751_text_formats_bad_nullable_parsing: [ OK ] 5.29 sec. 2025-10-09 11:56:01 00361_shared_array_offsets_and_squash_blocks: [ OK ] 0.62 sec. 2025-10-09 11:56:01 02015_async_inserts_7: [ OK ] 3.43 sec. 2025-10-09 11:56:02 02294_decimal_second_errors: [ OK ] 0.62 sec. 2025-10-09 11:56:02 02802_clickhouse_disks_s3_copy: [ OK ] 3.63 sec. 2025-10-09 11:56:03 03215_toStartOfWeek_with_dateTime64_fix: [ OK ] 0.57 sec. 2025-10-09 11:56:03 00723_remerge_sort: [ OK ] 1.02 sec. 2025-10-09 11:56:03 01607_arrays_as_nested_csv: [ OK ] 4.08 sec. 2025-10-09 11:56:04 00980_full_join_crash_fancyqlx: [ OK ] 0.62 sec. 2025-10-09 11:56:04 02187_test_final_and_limit_modifier: [ OK ] 0.57 sec. 2025-10-09 11:56:04 00732_base64_functions: [ OK ] 0.72 sec. 2025-10-09 11:56:05 01889_clickhouse_client_config_format: [ OK ] 4.23 sec. 2025-10-09 11:56:05 01508_race_condition_rename_clear_zookeeper_long: [ OK ] 29.00 sec. 2025-10-09 11:56:05 02560_analyzer_materialized_view: [ OK ] 0.72 sec. 2025-10-09 11:56:06 03113_analyzer_not_found_column_in_block_2: [ OK ] 0.62 sec. 2025-10-09 11:56:06 01460_allow_dollar_and_number_in_identifier: [ OK ] 0.52 sec. 2025-10-09 11:56:07 02481_default_value_used_in_row_level_filter: [ OK ] 0.62 sec. 2025-10-09 11:56:07 00368_format_option_collision: [ OK ] 2.03 sec. 2025-10-09 11:56:07 02049_lowcardinality_shortcircuit_crash: [ OK ] 0.67 sec. 2025-10-09 11:56:08 01945_show_debug_warning: [ OK ] 3.93 sec. 2025-10-09 11:56:08 01540_verbatim_partition_pruning: [ OK ] 0.87 sec. 2025-10-09 11:56:08 01710_projections_group_by_no_key: [ OK ] 0.62 sec. 2025-10-09 11:56:09 02500_remove_redundant_distinct_analyzer: [ OK ] 20.83 sec. 2025-10-09 11:56:10 03032_rmt_create_columns_from_replica: [ OK ] 0.52 sec. 2025-10-09 11:56:11 00459_group_array_insert_at: [ OK ] 0.62 sec. 2025-10-09 11:56:12 02984_form_format: [ OK ] 4.13 sec. 2025-10-09 11:56:13 03205_system_sync_replica_format: [ OK ] 0.53 sec. 2025-10-09 11:56:13 02932_idna: [ OK ] 2.13 sec. 2025-10-09 11:56:13 02817_structure_to_schema: [ OK ] 24.63 sec. 2025-10-09 11:56:14 02418_keeper_map_keys_limit: [ OK ] 0.77 sec. 2025-10-09 11:56:14 02274_full_sort_join_nodistinct: [ OK ] 8.54 sec. 2025-10-09 11:56:14 02474_fix_function_parser_bug: [ OK ] 0.47 sec. 2025-10-09 11:56:14 00938_fix_rwlock_segfault_long: [ OK ] 54.06 sec. 2025-10-09 11:56:14 01034_with_fill_and_push_down_predicate: [ OK ] 0.53 sec. 2025-10-09 11:56:14 02903_bug_43644: [ OK ] 0.72 sec. 2025-10-09 11:56:14 02898_parallel_replicas_custom_key_final: [ OK ] 0.77 sec. 2025-10-09 11:56:14 01134_max_rows_to_group_by: [ OK ] 0.92 sec. 2025-10-09 11:56:15 01009_insert_select_data_loss: [ OK ] 0.57 sec. 2025-10-09 11:56:15 02971_analyzer_remote_id: [ OK ] 2.33 sec. 2025-10-09 11:56:15 02790_fix_coredump_when_compile_expression: [ OK ] 0.52 sec. 2025-10-09 11:56:15 02029_quantile_sanitizer: [ OK ] 0.57 sec. 2025-10-09 11:56:16 00007_array: [ OK ] 0.58 sec. 2025-10-09 11:56:16 03196_max_intersections_arena_crash: [ OK ] 0.63 sec. 2025-10-09 11:56:16 02515_analyzer_null_for_empty: [ OK ] 0.57 sec. 2025-10-09 11:56:17 02669_alter_modify_to_nullable: [ OK ] 2.73 sec. 2025-10-09 11:56:17 01926_order_by_desc_limit: [ OK ] 9.09 sec. 2025-10-09 11:56:18 02024_join_on_or_long: [ OK ] 3.03 sec. 2025-10-09 11:56:19 01343_min_bytes_to_use_mmap_io: [ OK ] 1.23 sec. 2025-10-09 11:56:19 00843_optimize_predicate_and_rename_table: [ OK ] 0.67 sec. 2025-10-09 11:56:19 00872_t64_bit_codec: [ OK ] 2.58 sec. 2025-10-09 11:56:19 03167_base64_url_functions: [ OK ] 0.72 sec. 2025-10-09 11:56:19 03230_subcolumns_mv: [ OK ] 0.62 sec. 2025-10-09 11:56:20 01412_row_from_totals: [ OK ] 0.87 sec. 2025-10-09 11:56:20 03161_cnf_reduction: [ OK ] 0.82 sec. 2025-10-09 11:56:20 01131_max_rows_to_sort: [ OK ] 0.63 sec. 2025-10-09 11:56:21 02294_floating_point_second_in_settings: [ OK ] 6.09 sec. 2025-10-09 11:56:21 00589_removal_unused_columns_aggregation: [ OK ] 1.23 sec. 2025-10-09 11:56:21 00969_columns_clause: [ OK ] 0.72 sec. 2025-10-09 11:56:22 01533_distinct_depends_on_max_threads: [ OK ] 0.97 sec. 2025-10-09 11:56:22 00825_protobuf_format_skipped_column_in_nested: [ OK ] 4.18 sec. 2025-10-09 11:56:22 01424_parse_date_time_bad_date: [ OK ] 0.62 sec. 2025-10-09 11:56:22 01049_window_view_window_functions: [ OK ] 1.12 sec. 2025-10-09 11:56:22 01773_min_max_time_system_parts_datetime64: [ OK ] 0.57 sec. 2025-10-09 11:56:22 02571_local_desc_abort_on_twitter_json: [ OK ] 2.13 sec. 2025-10-09 11:56:23 03173_check_cyclic_dependencies_on_create_and_rename: [ OK ] 0.82 sec. 2025-10-09 11:56:23 01825_type_json_ghdata_insert_select: [ OK ] 20.08 sec. 2025-10-09 11:56:23 00060_date_lut: [ OK ] 0.52 sec. 2025-10-09 11:56:23 02983_empty_map: [ OK ] 1.48 sec. 2025-10-09 11:56:24 01666_lcm_ubsan: [ OK ] 0.77 sec. 2025-10-09 11:56:24 02560_window_ntile: [ OK ] 0.97 sec. 2025-10-09 11:56:25 03040_array_sum_and_join: [ OK ] 0.62 sec. 2025-10-09 11:56:25 02004_max_hyperscan_regex_length: [ OK ] 2.18 sec. 2025-10-09 11:56:27 02661_read_from_archive_tar: [ OK ] 19.37 sec. 2025-10-09 11:56:28 00746_compile_non_deterministic_function: [ OK ] 6.59 sec. 2025-10-09 11:56:29 02291_dictionary_scalar_subquery_reload: [ OK ] 0.62 sec. 2025-10-09 11:56:30 02192_comment_error: [ OK ] 3.13 sec. 2025-10-09 11:56:31 02332_dist_insert_send_logs_level: [ OK ] 2.28 sec. 2025-10-09 11:56:31 01949_heredoc_unfinished: [ OK ] 1.47 sec. 2025-10-09 11:56:32 01018_ambiguous_column: [ OK ] 0.67 sec. 2025-10-09 11:56:33 02344_distinct_limit_distiributed: [ OK ] 1.52 sec. 2025-10-09 11:56:33 02994_merge_tree_mutations_cleanup: [ OK ] 10.70 sec. 2025-10-09 11:56:33 01403_datetime64_constant_arg: [ OK ] 0.52 sec. 2025-10-09 11:56:33 02134_async_inserts_formats: [ OK ] 8.74 sec. 2025-10-09 11:56:34 00709_virtual_column_partition_id: [ OK ] 0.57 sec. 2025-10-09 11:56:34 02911_arrow_large_list: [ OK ] 1.72 sec. 2025-10-09 11:56:34 03261_sort_cursor_crash: [ OK ] 0.67 sec. 2025-10-09 11:56:34 00652_replicated_mutations_zookeeper: [ OK ] 18.32 sec. 2025-10-09 11:56:34 01274_alter_rename_column_distributed: [ OK ] 0.67 sec. 2025-10-09 11:56:34 02967_index_hint_crash: [ OK ] 0.57 sec. 2025-10-09 11:56:35 02412_nlp: [ OK ] 0.67 sec. 2025-10-09 11:56:35 01358_constexpr_constraint: [ OK ] 0.63 sec. 2025-10-09 11:56:36 00878_join_unexpected_results: [ OK ] 1.12 sec. 2025-10-09 11:56:36 02590_interserver_mode_client_info_initial_query_start_time: [ OK ] 10.95 sec. 2025-10-09 11:56:36 02002_system_table_with_tuple: [ OK ] 1.93 sec. 2025-10-09 11:56:36 01374_if_nullable_filimonov: [ OK ] 0.57 sec. 2025-10-09 11:56:36 01451_replicated_detach_drop_part_long: [ OK ] 0.97 sec. 2025-10-09 11:56:36 02995_index_10: [ SKIPPED ] 0.00 sec. 2025-10-09 11:56:36 Reason: not running for current build 2025-10-09 11:56:37 02986_leftpad_fixedstring: [ OK ] 0.67 sec. 2025-10-09 11:56:37 02891_alter_update_adaptive_granularity: [ OK ] 0.62 sec. 2025-10-09 11:56:37 01942_dateTimeToSnowflake: [ OK ] 0.98 sec. 2025-10-09 11:56:37 02414_all_new_table_functions_must_be_documented: [ OK ] 0.57 sec. 2025-10-09 11:56:37 02004_intersect_except_distinct_operators: [ OK ] 1.67 sec. 2025-10-09 11:56:38 02974_if_with_map: [ OK ] 0.77 sec. 2025-10-09 11:56:38 02458_empty_hdfs_url: [ OK ] 0.57 sec. 2025-10-09 11:56:38 00293_shard_max_subquery_depth: [ OK ] 0.64 sec. 2025-10-09 11:56:38 01338_long_select_and_alter: [ OK ] 15.71 sec. 2025-10-09 11:56:39 01123_parse_date_time_best_effort_even_more: [ OK ] 0.57 sec. 2025-10-09 11:56:39 01522_validate_alter_default: [ OK ] 0.62 sec. 2025-10-09 11:56:39 02811_invalid_embedded_rocksdb_create: [ OK ] 0.62 sec. 2025-10-09 11:56:40 01096_zeros: [ OK ] 0.62 sec. 2025-10-09 11:56:40 01921_datatype_date32: [ OK ] 1.88 sec. 2025-10-09 11:56:40 01016_macros: [ OK ] 0.57 sec. 2025-10-09 11:56:41 00534_functions_bad_arguments8: [ OK ] 16.66 sec. 2025-10-09 11:56:41 02911_cte_invalid_query_analysis: [ OK ] 0.62 sec. 2025-10-09 11:56:41 01018_ddl_dictionaries_special: [ OK ] 0.92 sec. 2025-10-09 11:56:42 01938_joins_identifiers: [ OK ] 0.57 sec. 2025-10-09 11:56:42 02990_arrayFold_nullable_lc: [ OK ] 0.98 sec. 2025-10-09 11:56:42 00953_constraints_operations: [ OK ] 7.14 sec. 2025-10-09 11:56:42 02543_alter_update_rename_stuck: [ OK ] 8.39 sec. 2025-10-09 11:56:42 00853_join_with_nulls_crash: [ OK ] 0.82 sec. 2025-10-09 11:56:42 02591_bson_long_tuple: [ OK ] 0.52 sec. 2025-10-09 11:56:42 03003_analyzer_setting: [ OK ] 0.57 sec. 2025-10-09 11:56:42 03049_unknown_identifier_materialized_column: [ OK ] 0.62 sec. 2025-10-09 11:56:43 02375_scalar_lc_cte: [ OK ] 0.57 sec. 2025-10-09 11:56:43 01680_date_time_add_ubsan: [ OK ] 0.92 sec. 2025-10-09 11:56:43 03037_dynamic_merges_2_horizontal_compact_merge_tree: [ SKIPPED ] 0.00 sec. 2025-10-09 11:56:43 Reason: not running for current build 2025-10-09 11:56:43 02504_parse_datetime_best_effort_calebeaires: [ OK ] 0.57 sec. 2025-10-09 11:56:43 02676_trailing_commas: [ OK ] 0.77 sec. 2025-10-09 11:56:44 02454_create_table_with_custom_disk: [ OK ] 0.68 sec. 2025-10-09 11:56:44 00341_squashing_insert_select2: [ OK ] 0.82 sec. 2025-10-09 11:56:44 02586_generate_random_structure: [ OK ] 0.92 sec. 2025-10-09 11:56:44 02042_map_get_non_const_key: [ OK ] 0.52 sec. 2025-10-09 11:56:44 02343_analyzer_column_transformers_strict: [ OK ] 0.67 sec. 2025-10-09 11:56:44 03023_zeros_generate_random_with_limit_progress_bar: [ OK ] 1.68 sec. 2025-10-09 11:56:45 00676_group_by_in: [ OK ] 0.62 sec. 2025-10-09 11:56:45 01922_sum_null_for_remote: [ OK ] 0.62 sec. 2025-10-09 11:56:45 00936_crc_functions: [ OK ] 0.77 sec. 2025-10-09 11:56:45 01825_new_type_json_in_array: [ OK ] 1.38 sec. 2025-10-09 11:56:45 00155_long_merges: [ SKIPPED ] 0.00 sec. 2025-10-09 11:56:45 Reason: not running for current build 2025-10-09 11:56:46 01825_type_json_ephemeral: [ OK ] 0.67 sec. 2025-10-09 11:56:46 01017_tuplehamming_distance: [ OK ] 0.62 sec. 2025-10-09 11:56:46 02918_join_pm_lc_crash: [ OK ] 0.62 sec. 2025-10-09 11:56:46 02071_lower_upper_utf8_row_overlaps: [ OK ] 0.62 sec. 2025-10-09 11:56:47 02843_context_has_expired: [ OK ] 0.72 sec. 2025-10-09 11:56:47 01410_nullable_key_and_index_negate_cond: [ OK ] 0.82 sec. 2025-10-09 11:56:47 00393_if_with_constant_condition: [ OK ] 0.58 sec. 2025-10-09 11:56:47 00800_low_cardinality_empty_array: [ OK ] 0.57 sec. 2025-10-09 11:56:47 00559_filter_array_generic: [ OK ] 0.52 sec. 2025-10-09 11:56:48 01948_group_bitmap_and_or_xor_fix: [ OK ] 0.52 sec. 2025-10-09 11:56:48 02122_join_group_by_timeout: [ OK ] 10.25 sec. 2025-10-09 11:56:48 00098_a_union_all: [ OK ] 0.52 sec. 2025-10-09 11:56:48 02872_null_as_default_nested: [ OK ] 9.14 sec. 2025-10-09 11:56:48 02245_s3_virtual_columns: [ OK ] 0.67 sec. 2025-10-09 11:56:49 02311_range_hashed_dictionary_range_cast: [ OK ] 0.62 sec. 2025-10-09 11:56:49 02911_add_index_and_materialize_index: [ OK ] 0.52 sec. 2025-10-09 11:56:49 00712_prewhere_with_alias: [ OK ] 0.92 sec. 2025-10-09 11:56:50 01268_procfs_metrics: [ OK ] 2.83 sec. 2025-10-09 11:56:50 02302_clash_const_aggegate_join: [ OK ] 0.77 sec. 2025-10-09 11:56:51 01835_alias_to_primary_key_cyfdecyf: [ OK ] 0.57 sec. 2025-10-09 11:56:51 02122_parallel_formatting_JSONCompactStrings: [ OK ] 6.14 sec. 2025-10-09 11:56:51 00457_log_tinylog_stripelog_nullable: [ OK ] 1.07 sec. 2025-10-09 11:56:51 02864_profile_event_part_lock: [ OK ] 0.58 sec. 2025-10-09 11:56:51 02254_projection_broken_part: [ OK ] 9.65 sec. 2025-10-09 11:56:52 02811_parallel_replicas_prewhere_count: [ OK ] 0.63 sec. 2025-10-09 11:56:52 03013_forbid_attach_table_if_active_replica_already_exists: [ OK ] 4.28 sec. 2025-10-09 11:56:52 02177_merge_optimize_aggregation_in_order: [ OK ] 0.62 sec. 2025-10-09 11:56:52 02016_summing_mt_aggregating_column: [ OK ] 0.82 sec. 2025-10-09 11:56:52 03037_dynamic_merges_1_horizontal_compact_wide_tree: [ SKIPPED ] 0.00 sec. 2025-10-09 11:56:52 Reason: not running for current build 2025-10-09 11:56:53 02933_ephemeral_mv: [ OK ] 0.68 sec. 2025-10-09 11:56:53 02875_merge_engine_set_index: [ OK ] 4.28 sec. 2025-10-09 11:56:54 03093_special_column_errors: [ OK ] 1.27 sec. 2025-10-09 11:56:54 00971_merge_tree_uniform_read_distribution_and_max_rows_to_read: [ OK ] 0.73 sec. 2025-10-09 11:56:54 02539_generate_random_ip: [ OK ] 0.58 sec. 2025-10-09 11:56:55 02292_nested_not_flattened_detach: [ OK ] 0.47 sec. 2025-10-09 11:56:55 02378_part_log_profile_events: [ OK ] 2.68 sec. 2025-10-09 11:56:55 03131_rewrite_sum_if_nullable: [ OK ] 0.82 sec. 2025-10-09 11:56:56 02997_projections_formatting: [ OK ] 0.47 sec. 2025-10-09 11:56:56 02518_delete_on_materialized_view: [ OK ] 0.72 sec. 2025-10-09 11:56:57 00961_check_table: [ OK ] 0.73 sec. 2025-10-09 11:56:57 00681_duplicate_columns_inside_union_all_stas_sviridov: [ OK ] 0.57 sec. 2025-10-09 11:56:57 02789_reading_from_s3_with_connection_pool: [ OK ] 8.04 sec. 2025-10-09 11:56:57 03002_map_array_functions_with_low_cardinality: [ OK ] 0.52 sec. 2025-10-09 11:56:58 01615_two_args_function_index_fix: [ OK ] 0.57 sec. 2025-10-09 11:56:58 01710_projection_group_by_order_by: [ OK ] 0.47 sec. 2025-10-09 11:56:59 02553_type_object_analyzer: [ OK ] 0.62 sec. 2025-10-09 11:57:00 02803_backup_tmp_files: [ OK ] 3.13 sec. 2025-10-09 11:57:00 02578_ipv4_codec_t64: [ OK ] 0.47 sec. 2025-10-09 11:57:01 02843_backup_use_same_password_for_base_backup: [ OK ] 9.45 sec. 2025-10-09 11:57:01 02815_logical_error_cannot_get_column_name_of_set: [ OK ] 0.57 sec. 2025-10-09 11:57:01 00287_column_const_with_nan: [ OK ] 0.47 sec. 2025-10-09 11:57:01 02345_create_table_allow_trailing_comma: [ OK ] 0.62 sec. 2025-10-09 11:57:02 02125_lz4_compression_bug_JSONCompactEachRow: [ OK ] 10.60 sec. 2025-10-09 11:57:02 00574_empty_strings_deserialization: [ OK ] 4.58 sec. 2025-10-09 11:57:02 01255_geo_types_livace: [ OK ] 0.59 sec. 2025-10-09 11:57:03 03040_dynamic_type_alters_1_wide_merge_tree: [ OK ] 1.47 sec. 2025-10-09 11:57:03 01513_defaults_on_defaults_no_column: [ OK ] 0.62 sec. 2025-10-09 11:57:03 02118_deserialize_whole_text: [ OK ] 11.30 sec. 2025-10-09 11:57:03 02205_map_populate_series_non_const: [ OK ] 1.22 sec. 2025-10-09 11:57:03 01293_client_interactive_vertical_singleline: [ OK ] 1.93 sec. 2025-10-09 11:57:04 01116_cross_count_asterisks: [ OK ] 0.57 sec. 2025-10-09 11:57:04 01425_default_value_of_type_name: [ OK ] 0.57 sec. 2025-10-09 11:57:04 02798_generic_transform: [ OK ] 0.57 sec. 2025-10-09 11:57:04 00974_fix_join_on: [ OK ] 1.17 sec. 2025-10-09 11:57:04 00712_prewhere_with_alias_bug: [ OK ] 0.57 sec. 2025-10-09 11:57:05 01602_runningConcurrency: [ OK ] 0.92 sec. 2025-10-09 11:57:05 02814_ReplacingMergeTree_fix_select_final_on_single_partition: [ OK ] 0.62 sec. 2025-10-09 11:57:05 01097_pre_limit: [ OK ] 0.52 sec. 2025-10-09 11:57:05 02286_tuple_numeric_identifier: [ OK ] 0.67 sec. 2025-10-09 11:57:05 01837_cast_to_array_from_empty_array: [ OK ] 0.52 sec. 2025-10-09 11:57:05 01825_new_type_json_9: [ OK ] 0.62 sec. 2025-10-09 11:57:06 00445_join_nullable_keys: [ OK ] 0.63 sec. 2025-10-09 11:57:06 00757_enum_defaults_const_analyzer: [ OK ] 0.57 sec. 2025-10-09 11:57:06 03131_deprecated_functions: [ OK ] 0.72 sec. 2025-10-09 11:57:06 02875_show_functions: [ OK ] 3.03 sec. 2025-10-09 11:57:06 00926_adaptive_index_granularity_collapsing_merge_tree: [ OK ] 0.87 sec. 2025-10-09 11:57:07 02679_query_parameters_dangling_pointer: [ OK ] 0.57 sec. 2025-10-09 11:57:07 00632_get_sample_block_cache: [ SKIPPED ] 0.00 sec. 2025-10-09 11:57:07 Reason: not running for current build 2025-10-09 11:57:07 01071_force_optimize_skip_unused_shards: [ OK ] 0.92 sec. 2025-10-09 11:57:07 02935_ipv6_bit_operations: [ OK ] 0.52 sec. 2025-10-09 11:57:07 01410_full_join_and_null_predicates: [ OK ] 0.82 sec. 2025-10-09 11:57:08 02560_regexp_denial_of_service: [ OK ] 1.48 sec. 2025-10-09 11:57:08 02267_jsonlines_ndjson_format: [ OK ] 0.52 sec. 2025-10-09 11:57:08 00668_compare_arrays_silviucpp: [ OK ] 0.57 sec. 2025-10-09 11:57:09 02206_clickhouse_local_use_database: [ OK ] 1.83 sec. 2025-10-09 11:57:10 02493_numeric_literals_with_underscores: [ OK ] 1.58 sec. 2025-10-09 11:57:11 02456_async_inserts_logs: [ OK ] 11.81 sec. 2025-10-09 11:57:11 03207_json_read_subcolumns_1_memory: [ OK ] 3.08 sec. 2025-10-09 11:57:11 02911_analyzer_explain_estimate: [ OK ] 0.52 sec. 2025-10-09 11:57:12 01791_dist_INSERT_block_structure_mismatch: [ OK ] 2.03 sec. 2025-10-09 11:57:12 02956_clickhouse_local_system_parts: [ OK ] 2.08 sec. 2025-10-09 11:57:12 01660_join_or_inner: [ OK ] 0.87 sec. 2025-10-09 11:57:12 01049_zookeeper_synchronous_mutations_long: [ OK ] 1.22 sec. 2025-10-09 11:57:12 02921_fuzzbits_with_array_join: [ OK ] 0.52 sec. 2025-10-09 11:57:12 02347_rank_corr_nan: [ OK ] 0.52 sec. 2025-10-09 11:57:13 00520_tuple_values_interpreter: [ OK ] 0.57 sec. 2025-10-09 11:57:13 00698_validate_array_sizes_for_nested: [ OK ] 0.58 sec. 2025-10-09 11:57:13 03002_int_div_decimal_with_date_bug: [ OK ] 0.62 sec. 2025-10-09 11:57:13 03203_variant_convert_field_to_type_bug: [ OK ] 0.52 sec. 2025-10-09 11:57:13 01518_nullable_aggregate_states2: [ OK ] 6.49 sec. 2025-10-09 11:57:13 02461_welch_t_test_fuzz: [ OK ] 0.52 sec. 2025-10-09 11:57:13 00938_dataset_test: [ OK ] 0.57 sec. 2025-10-09 11:57:14 02021_h3_is_res_classIII: [ OK ] 0.62 sec. 2025-10-09 11:57:14 00275_shard_quantiles_weighted: [ OK ] 1.02 sec. 2025-10-09 11:57:14 03036_dynamic_read_shared_subcolumns_memory: [ SKIPPED ] 0.00 sec. 2025-10-09 11:57:14 Reason: not running for current build 2025-10-09 11:57:14 01748_partition_id_pruning: [ OK ] 0.77 sec. 2025-10-09 11:57:14 02933_sqid: [ OK ] 2.48 sec. 2025-10-09 11:57:16 00940_order_by_read_in_order: [ OK ] 1.53 sec. 2025-10-09 11:57:16 00507_array_no_params: [ OK ] 2.98 sec. 2025-10-09 11:57:17 01825_new_type_json_distributed: [ OK ] 0.67 sec. 2025-10-09 11:57:17 01455_nullable_type_with_if_agg_combinator: [ OK ] 0.57 sec. 2025-10-09 11:57:18 01746_forbid_drop_column_referenced_by_mv: [ OK ] 1.08 sec. 2025-10-09 11:57:18 02477_age_date32: [ OK ] 1.32 sec. 2025-10-09 11:57:18 02122_parallel_formatting_JSONCompactEachRow: [ OK ] 4.18 sec. 2025-10-09 11:57:19 01049_join_low_card_crash: [ OK ] 0.72 sec. 2025-10-09 11:57:19 02940_json_array_of_unnamed_tuples_inference: [ OK ] 0.47 sec. 2025-10-09 11:57:20 02947_dropped_tables_parts: [ OK ] 0.57 sec. 2025-10-09 11:57:21 03006_mv_deduplication_throw_if_async_insert: [ OK ] 0.87 sec. 2025-10-09 11:57:21 02974_analyzer_array_join_subcolumn: [ OK ] 0.67 sec. 2025-10-09 11:57:22 00097_long_storage_buffer_race_condition: [ OK ] 27.34 sec. 2025-10-09 11:57:22 00929_multi_match_edit_distance: [ OK ] 3.73 sec. 2025-10-09 11:57:22 02155_dictionary_comment: [ OK ] 0.92 sec. 2025-10-09 11:57:22 00473_output_format_json_quote_denormals: [ OK ] 4.33 sec. 2025-10-09 11:57:23 01475_read_subcolumns_2: [ OK ] 0.92 sec. 2025-10-09 11:57:23 01511_different_expression_with_same_alias: [ OK ] 0.52 sec. 2025-10-09 11:57:23 01213_alter_rename_nested: [ OK ] 0.77 sec. 2025-10-09 11:57:23 01085_extract_all_empty: [ OK ] 0.52 sec. 2025-10-09 11:57:24 02043_user_defined_executable_function_implicit_cast: [ OK ] 0.82 sec. 2025-10-09 11:57:24 02963_single_value_destructor: [ OK ] 0.97 sec. 2025-10-09 11:57:24 01651_map_functions: [ OK ] 1.48 sec. 2025-10-09 11:57:24 00351_select_distinct_arrays_tuples: [ OK ] 0.52 sec. 2025-10-09 11:57:24 01604_explain_ast_of_nonselect_query: [ OK ] 0.47 sec. 2025-10-09 11:57:25 00739_array_element_nullable_string_mattrobenolt: [ OK ] 0.62 sec. 2025-10-09 11:57:25 01038_array_of_unnamed_tuples: [ OK ] 0.52 sec. 2025-10-09 11:57:25 01880_materialized_view_to_table_type_check: [ OK ] 0.88 sec. 2025-10-09 11:57:26 02047_log_family_complex_structs_data_file_dumps: [ OK ] 11.60 sec. 2025-10-09 11:57:26 01605_drop_settings_profile_while_assigned: [ OK ] 0.57 sec. 2025-10-09 11:57:26 00800_low_cardinality_merge_join: [ OK ] 2.58 sec. 2025-10-09 11:57:26 02389_analyzer_nested_lambda: [ OK ] 12.40 sec. 2025-10-09 11:57:27 01560_optimize_on_insert_zookeeper: [ OK ] 0.82 sec. 2025-10-09 11:57:27 00431_if_nulls: [ OK ] 2.48 sec. 2025-10-09 11:57:28 02220_array_join_format: [ OK ] 0.57 sec. 2025-10-09 11:57:28 02911_system_symbols: [ OK ] 1.78 sec. 2025-10-09 11:57:28 02507_to_unix_timestamp_overflow: [ OK ] 0.63 sec. 2025-10-09 11:57:29 03215_parallel_replicas_crash_after_refactoring: [ OK ] 0.67 sec. 2025-10-09 11:57:29 02267_file_globs_schema_inference: [ OK ] 5.13 sec. 2025-10-09 11:57:29 02950_reading_array_tuple_subcolumns: [ OK ] 1.43 sec. 2025-10-09 11:57:29 00477_parsing_data_types: [ OK ] 0.52 sec. 2025-10-09 11:57:29 02874_analysis_of_variance_overflow: [ OK ] 0.47 sec. 2025-10-09 11:57:30 01025_array_compact_generic: [ OK ] 0.62 sec. 2025-10-09 11:57:30 01073_bad_alter_partition: [ OK ] 0.67 sec. 2025-10-09 11:57:30 02417_null_variadic_behaviour: [ OK ] 1.07 sec. 2025-10-09 11:57:30 03018_external_with_complex_data_types: [ OK ] 1.88 sec. 2025-10-09 11:57:31 00239_type_conversion_in_in: [ OK ] 0.52 sec. 2025-10-09 11:57:31 02242_optimize_to_subcolumns_no_storage: [ OK ] 0.52 sec. 2025-10-09 11:57:31 01780_column_sparse_filter: [ OK ] 0.83 sec. 2025-10-09 11:57:31 01062_pm_multiple_all_join_same_value: [ OK ] 0.62 sec. 2025-10-09 11:57:32 01554_interpreter_integer_float: [ OK ] 0.57 sec. 2025-10-09 11:57:32 02151_replace_regexp_all_empty_match_alternative: [ OK ] 0.67 sec. 2025-10-09 11:57:32 02294_system_certificates: [ OK ] 0.50 sec. 2025-10-09 11:57:32 00700_decimal_empty_aggregates: [ OK ] 1.43 sec. 2025-10-09 11:57:33 00120_join_and_group_by: [ OK ] 0.52 sec. 2025-10-09 11:57:33 02354_with_statement_non_exist_column: [ OK ] 0.52 sec. 2025-10-09 11:57:33 01772_to_start_of_hour_align: [ OK ] 0.67 sec. 2025-10-09 11:57:33 01213_alter_table_rename_nested: [ OK ] 0.72 sec. 2025-10-09 11:57:34 03169_cache_complex_dict_short_circuit_bug: [ OK ] 0.62 sec. 2025-10-09 11:57:34 00960_eval_ml_method_const: [ OK ] 0.52 sec. 2025-10-09 11:57:34 00673_subquery_prepared_set_performance: [ OK ] 1.08 sec. 2025-10-09 11:57:35 00263_merge_aggregates_and_overflow: [ OK ] 0.62 sec. 2025-10-09 11:57:35 00725_memory_tracking: [ OK ] 0.97 sec. 2025-10-09 11:57:36 02875_fix_column_decimal_serialization: [ OK ] 0.87 sec. 2025-10-09 11:57:36 02271_replace_partition_many_tables: [ OK ] 31.05 sec. 2025-10-09 11:57:36 01667_aes_args_check: [ OK ] 0.57 sec. 2025-10-09 11:57:36 00353_join_by_tuple: [ OK ] 0.57 sec. 2025-10-09 11:57:36 02813_series_period_detect: [ OK ] 0.78 sec. 2025-10-09 11:57:37 01034_move_partition_from_table_zookeeper: [ OK ] 59.19 sec. 2025-10-09 11:57:37 03164_adapting_parquet_reader_output_size: [ OK ] 3.73 sec. 2025-10-09 11:57:37 01202_array_auc_special: [ OK ] 0.82 sec. 2025-10-09 11:57:37 00315_quantile_off_by_one: [ OK ] 0.57 sec. 2025-10-09 11:57:38 01846_alter_column_without_type_bugfix: [ OK ] 0.52 sec. 2025-10-09 11:57:38 01529_union_distinct_and_setting_union_default_mode: [ OK ] 0.97 sec. 2025-10-09 11:57:38 01548_uncomparable_columns_in_keys: [ OK ] 0.62 sec. 2025-10-09 11:57:39 02725_cnf_large_check: [ OK ] 1.08 sec. 2025-10-09 11:57:39 02010_lc_native: [ OK ] 3.28 sec. 2025-10-09 11:57:41 00678_shard_funnel_window: [ OK ] 1.28 sec. 2025-10-09 11:57:41 01514_parallel_formatting: [ OK ] 4.23 sec. 2025-10-09 11:57:42 01802_rank_corr_mann_whitney_over_window: [ OK ] 0.63 sec. 2025-10-09 11:57:42 01825_type_json_15: [ OK ] 5.04 sec. 2025-10-09 11:57:42 02899_indexing_by_space_filling_curves: [ OK ] 1.23 sec. 2025-10-09 11:57:42 02910_bad_logs_level_in_local: [ OK ] 0.52 sec. 2025-10-09 11:57:42 00129_quantile_timing_weighted: [ OK ] 0.63 sec. 2025-10-09 11:57:43 01144_multiple_joins_rewriter_v2_and_lambdas: [ OK ] 0.73 sec. 2025-10-09 11:57:43 02033_join_engine_deadlock_long: [ OK ] 4.93 sec. 2025-10-09 11:57:43 01581_deduplicate_by_columns_replicated_long: [ OK ] 0.98 sec. 2025-10-09 11:57:43 00490_special_line_separators_and_characters_outside_of_bmp: [ OK ] 0.52 sec. 2025-10-09 11:57:44 03058_analyzer_ambiguous_columns: [ OK ] 0.72 sec. 2025-10-09 11:57:44 01034_values_parse_float_bug: [ OK ] 4.83 sec. 2025-10-09 11:57:45 02296_nullable_arguments_in_array_filter: [ OK ] 0.57 sec. 2025-10-09 11:57:45 02675_sparse_columns_clear_column: [ OK ] 1.98 sec. 2025-10-09 11:57:46 02433_default_expression_operator_in: [ OK ] 0.87 sec. 2025-10-09 11:57:46 03207_composite_expressions_lambda_consistent_formatting: [ OK ] 0.68 sec. 2025-10-09 11:57:46 01526_initial_query_id: [ OK ] 3.73 sec. 2025-10-09 11:57:46 01020_function_char: [ OK ] 0.52 sec. 2025-10-09 11:57:46 02235_add_part_offset_virtual_column: [ OK ] 3.03 sec. 2025-10-09 11:57:47 01544_fromModifiedJulianDay: [ OK ] 0.88 sec. 2025-10-09 11:57:47 02131_materialize_column_cast: [ OK ] 0.77 sec. 2025-10-09 11:57:47 03153_dynamic_type_empty: [ OK ] 0.62 sec. 2025-10-09 11:57:48 00839_bitmask_negative: [ OK ] 0.77 sec. 2025-10-09 11:57:48 02842_suggest_http_page_in_error_message: [ OK ] 1.63 sec. 2025-10-09 11:57:48 01922_array_join_with_index: [ OK ] 0.68 sec. 2025-10-09 11:57:48 03034_recursive_cte_tree_fuzz_crash_fix: [ OK ] 1.48 sec. 2025-10-09 11:57:48 00520_http_nullable: [ OK ] 1.78 sec. 2025-10-09 11:57:49 02995_bad_formatting_union_intersect: [ OK ] 0.62 sec. 2025-10-09 11:57:49 03214_backup_and_clear_old_temporary_directories: [ OK ] 5.68 sec. 2025-10-09 11:57:49 02886_missed_json_subcolumns: [ OK ] 0.93 sec. 2025-10-09 11:57:50 01710_projection_with_column_transformers: [ OK ] 0.57 sec. 2025-10-09 11:57:50 02415_all_new_functions_must_be_documented: [ OK ] 0.62 sec. 2025-10-09 11:57:50 02900_matview_create_to_errors: [ OK ] 1.89 sec. 2025-10-09 11:57:50 00620_optimize_on_nonleader_replica_zookeeper: [ OK ] 0.83 sec. 2025-10-09 11:57:50 02473_multistep_prewhere: [ OK ] 24.44 sec. 2025-10-09 11:57:51 03003_enum_and_string_compatible: [ OK ] 0.47 sec. 2025-10-09 11:57:51 00944_ml_test: [ OK ] 0.62 sec. 2025-10-09 11:57:51 01497_extract_all_groups_empty_match: [ OK ] 0.52 sec. 2025-10-09 11:57:51 01518_nullable_aggregate_states1: [ OK ] 0.67 sec. 2025-10-09 11:57:51 02155_parse_date_lowcard_default_throw: [ OK ] 0.52 sec. 2025-10-09 11:57:51 00601_kill_running_query: [ OK ] 1.48 sec. 2025-10-09 11:57:51 01474_decimal_scale_bug: [ OK ] 0.67 sec. 2025-10-09 11:57:52 00069_date_arithmetic: [ OK ] 0.67 sec. 2025-10-09 11:57:52 03152_dynamic_type_simple: [ OK ] 0.63 sec. 2025-10-09 11:57:52 02812_pointwise_array_operations: [ OK ] 0.87 sec. 2025-10-09 11:57:52 01634_summap_nullable: [ OK ] 0.52 sec. 2025-10-09 11:57:53 01632_nullable_string_type_convert_to_decimal_type: [ OK ] 0.57 sec. 2025-10-09 11:57:53 00628_in_lambda_on_merge_table_bug: [ OK ] 0.78 sec. 2025-10-09 11:57:53 01413_truncate_without_table_keyword: [ OK ] 0.57 sec. 2025-10-09 11:57:53 02301_harmful_reexec: [ OK ] 2.18 sec. 2025-10-09 11:57:54 01032_duplicate_column_insert_query: [ OK ] 0.62 sec. 2025-10-09 11:57:54 02366_kql_distinct: [ OK ] 0.77 sec. 2025-10-09 11:57:54 00580_consistent_hashing_functions: [ OK ] 0.57 sec. 2025-10-09 11:57:54 02518_parquet_arrow_orc_boolean_value: [ OK ] 2.68 sec. 2025-10-09 11:57:55 03006_join_on_inequal_expression_3: [ OK ] 1.18 sec. 2025-10-09 11:57:55 00937_ipv4_cidr_range: [ OK ] 0.67 sec. 2025-10-09 11:57:55 03150_dynamic_type_mv_insert: [ OK ] 0.97 sec. 2025-10-09 11:57:56 00335_bom: [ OK ] 1.62 sec. 2025-10-09 11:57:56 01072_drop_temporary_table_with_same_name: [ OK ] 0.67 sec. 2025-10-09 11:57:57 02764_parallel_replicas_plain_merge_tree: [ OK ] 0.62 sec. 2025-10-09 11:57:57 02900_clickhouse_local_drop_current_database: [ OK ] 1.83 sec. 2025-10-09 11:57:57 00696_system_columns_limit: [ OK ] 0.72 sec. 2025-10-09 11:57:57 02797_range_nullable: [ OK ] 0.67 sec. 2025-10-09 11:57:57 01284_view_and_extremes_bug: [ OK ] 0.57 sec. 2025-10-09 11:57:58 01436_storage_merge_with_join_push_down: [ OK ] 0.64 sec. 2025-10-09 11:57:58 01631_date_overflow_as_partition_key: [ OK ] 0.72 sec. 2025-10-09 11:57:59 02675_grant_query_formatting: [ OK ] 1.63 sec. 2025-10-09 11:58:00 02366_kql_func_dynamic: [ OK ] 2.73 sec. 2025-10-09 11:58:00 03199_queries_with_new_analyzer: [ OK ] 0.77 sec. 2025-10-09 11:58:00 02024_create_dictionary_with_comment: [ OK ] 0.47 sec. 2025-10-09 11:58:01 02843_backup_use_same_s3_credentials_for_base_backup: [ OK ] 10.25 sec. 2025-10-09 11:58:01 01412_group_array_moving_shard: [ OK ] 1.12 sec. 2025-10-09 11:58:01 03048_not_found_column_xxx_in_block: [ OK ] 0.67 sec. 2025-10-09 11:58:01 00411_long_accurate_number_comparison_int1: [ OK ] 35.02 sec. 2025-10-09 11:58:02 02152_dictionary_date32_type: [ OK ] 0.62 sec. 2025-10-09 11:58:02 02381_analyzer_join_final: [ OK ] 0.62 sec. 2025-10-09 11:58:02 02918_optimize_count_for_merge_tables: [ OK ] 0.67 sec. 2025-10-09 11:58:02 03015_peder1001: [ OK ] 0.63 sec. 2025-10-09 11:58:03 01273_arrow: [ OK ] 33.17 sec. 2025-10-09 11:58:03 00453_top_k: [ OK ] 0.57 sec. 2025-10-09 11:58:03 02260_alter_compact_part_drop_nested_column: [ OK ] 0.77 sec. 2025-10-09 11:58:04 02791_final_block_structure_mismatch_bug: [ OK ] 1.07 sec. 2025-10-09 11:58:05 00396_uuid: [ OK ] 0.62 sec. 2025-10-09 11:58:07 02373_datetime64_monotonicity: [ OK ] 5.54 sec. 2025-10-09 11:58:07 00560_float_leading_plus_in_exponent: [ OK ] 0.52 sec. 2025-10-09 11:58:08 01927_query_views_log_matview_exceptions: [ OK ] 9.51 sec. 2025-10-09 11:58:08 02981_variant_type_function: [ OK ] 0.67 sec. 2025-10-09 11:58:09 00975_json_hang: [ OK ] 1.28 sec. 2025-10-09 11:58:09 02270_errors_in_files: [ OK ] 6.64 sec. 2025-10-09 11:58:09 03207_json_read_subcolumns_1_compact_merge_tree: [ OK ] 5.64 sec. 2025-10-09 11:58:09 02162_array_first_last_index: [ OK ] 0.67 sec. 2025-10-09 11:58:09 03038_nested_dynamic_merges_wide_horizontal: [ SKIPPED ] 0.00 sec. 2025-10-09 11:58:09 Reason: not running for current build 2025-10-09 11:58:09 00753_distributed_system_columns_and_system_tables: [ OK ] 0.62 sec. 2025-10-09 11:58:09 02316_const_string_intersact: [ OK ] 0.62 sec. 2025-10-09 11:58:09 02961_analyzer_low_cardinality_fuzzer: [ OK ] 0.62 sec. 2025-10-09 11:58:10 00564_temporary_table_management: [ OK ] 0.47 sec. 2025-10-09 11:58:10 01821_join_table_mutation: [ OK ] 0.72 sec. 2025-10-09 11:58:10 00622_select_in_parens: [ OK ] 0.53 sec. 2025-10-09 11:58:11 02319_dict_get_check_arguments_size: [ OK ] 0.82 sec. 2025-10-09 11:58:11 02233_HTTP_ranged: [ OK ] 2.23 sec. 2025-10-09 11:58:12 00534_exp10: [ OK ] 0.52 sec. 2025-10-09 11:58:12 03153_format_regexp_usability: [ OK ] 2.48 sec. 2025-10-09 11:58:13 02735_array_map_array_of_tuples: [ OK ] 0.57 sec. 2025-10-09 11:58:13 00760_insert_json_with_defaults: [ OK ] 0.88 sec. 2025-10-09 11:58:13 01768_extended_range: [ OK ] 0.57 sec. 2025-10-09 11:58:14 01064_incremental_streaming_from_2_src_with_feedback: [ OK ] 3.28 sec. 2025-10-09 11:58:14 02191_parse_date_time_best_effort_more_cases: [ OK ] 0.68 sec. 2025-10-09 11:58:14 00999_test_skip_indices_with_alter_and_merge: [ OK ] 0.62 sec. 2025-10-09 11:58:14 00114_float_type_result_of_division: [ OK ] 0.52 sec. 2025-10-09 11:58:14 02874_parse_json_as_json_each_row_on_no_metadata: [ OK ] 0.53 sec. 2025-10-09 11:58:15 01661_week_functions_string_args: [ OK ] 1.07 sec. 2025-10-09 11:58:15 01511_alter_version_versioned_collapsing_merge_tree: [ OK ] 0.87 sec. 2025-10-09 11:58:15 02402_merge_engine_with_view: [ OK ] 0.62 sec. 2025-10-09 11:58:15 00122_join_with_subquery_with_subquery: [ OK ] 0.53 sec. 2025-10-09 11:58:15 01031_mutations_interpreter_and_context: [ OK ] 4.74 sec. 2025-10-09 11:58:16 02941_variant_type_1: [ OK ] 27.19 sec. 2025-10-09 11:58:16 00014_select_from_table_with_nested: [ OK ] 0.62 sec. 2025-10-09 11:58:16 02311_normalize_utf8_constant: [ OK ] 0.52 sec. 2025-10-09 11:58:17 00465_nullable_default: [ OK ] 0.57 sec. 2025-10-09 11:58:17 02381_arrow_dict_to_lc: [ OK ] 1.78 sec. 2025-10-09 11:58:17 02864_filtered_url_with_globs: [ OK ] 0.57 sec. 2025-10-09 11:58:18 00324_hashing_enums: [ OK ] 0.57 sec. 2025-10-09 11:58:18 03156_default_multiquery_split: [ OK ] 2.58 sec. 2025-10-09 11:58:18 02241_short_circuit_short_column: [ OK ] 0.57 sec. 2025-10-09 11:58:19 01284_port: [ OK ] 1.27 sec. 2025-10-09 11:58:19 00650_array_enumerate_uniq_with_tuples: [ OK ] 0.72 sec. 2025-10-09 11:58:19 03036_test_parquet_bloom_filter_push_down: [ OK ] 13.55 sec. 2025-10-09 11:58:19 02497_source_part_is_intact_when_mutation: [ OK ] 0.67 sec. 2025-10-09 11:58:19 02554_format_json_columns_for_empty: [ OK ] 0.52 sec. 2025-10-09 11:58:19 02832_transform_fixed_string_no_default: [ OK ] 0.52 sec. 2025-10-09 11:58:20 01097_cyclic_defaults: [ OK ] 0.92 sec. 2025-10-09 11:58:20 02696_ignore_inacc_tables_mat_view_atttach: [ OK ] 0.62 sec. 2025-10-09 11:58:20 02381_parse_array_of_tuples: [ OK ] 0.52 sec. 2025-10-09 11:58:20 01125_generate_random_qoega: [ OK ] 1.23 sec. 2025-10-09 11:58:21 02477_age_datetime64: [ OK ] 1.03 sec. 2025-10-09 11:58:21 02122_parallel_formatting_Vertical: [ OK ] 5.13 sec. 2025-10-09 11:58:21 00662_has_nullable: [ OK ] 0.72 sec. 2025-10-09 11:58:21 03156_analyzer_array_join_distributed: [ OK ] 0.82 sec. 2025-10-09 11:58:21 03013_repeat_with_nonnative_integers: [ OK ] 0.52 sec. 2025-10-09 11:58:22 01020_having_without_group_by: [ OK ] 0.52 sec. 2025-10-09 11:58:22 01583_parallel_parsing_exception_with_offset: [ OK ] 7.14 sec. 2025-10-09 11:58:22 00173_compare_date_time_with_constant_string: [ OK ] 1.43 sec. 2025-10-09 11:58:22 00730_unicode_terminal_format: [ OK ] 0.67 sec. 2025-10-09 11:58:23 01702_rewrite_avg_for_algebraic_optimization: [ OK ] 0.77 sec. 2025-10-09 11:58:23 02377_analyzer_in_function_set: [ OK ] 0.67 sec. 2025-10-09 11:58:24 03165_distinct_with_window_func_crash: [ OK ] 0.57 sec. 2025-10-09 11:58:24 02800_clickhouse_local_default_settings: [ OK ] 1.73 sec. 2025-10-09 11:58:24 02532_send_logs_level_test: [ OK ] 2.93 sec. 2025-10-09 11:58:24 03200_subcolumns_join_use_nulls: [ OK ] 0.57 sec. 2025-10-09 11:58:25 00082_append_trailing_char_if_absent: [ OK ] 0.57 sec. 2025-10-09 11:58:25 01662_join_mixed: [ OK ] 0.52 sec. 2025-10-09 11:58:25 01518_select_in_null: [ OK ] 2.03 sec. 2025-10-09 11:58:25 01552_dict_fixedstring: [ OK ] 0.57 sec. 2025-10-09 11:58:25 01528_clickhouse_local_prepare_parts: [ OK ] 6.34 sec. 2025-10-09 11:58:26 03167_parametrized_view_with_cte: [ OK ] 0.57 sec. 2025-10-09 11:58:26 00450_higher_order_and_nullable: [ OK ] 0.52 sec. 2025-10-09 11:58:27 02844_max_backup_bandwidth_s3: [ OK ] 32.01 sec. 2025-10-09 11:58:27 00647_multiply_aggregation_state: [ OK ] 0.82 sec. 2025-10-09 11:58:27 03023_invalid_format_detection: [ OK ] 2.03 sec. 2025-10-09 11:58:27 01881_join_on_conditions_merge: [ OK ] 2.63 sec. 2025-10-09 11:58:28 01554_row_number_after_cannot_read_all_data: [ OK ] 2.08 sec. 2025-10-09 11:58:28 02504_disallow_arrayjoin_in_mutations: [ OK ] 0.57 sec. 2025-10-09 11:58:28 02029_test_implemented_methods: [ OK ] 1.53 sec. 2025-10-09 11:58:29 01199_url_functions_path_without_schema_yiurule: [ OK ] 0.47 sec. 2025-10-09 11:58:29 01273_arrow_nullable_arrays_load: [ OK ] 4.68 sec. 2025-10-09 11:58:29 00029_test_zookeeper_optimize_exception: [ OK ] 8.05 sec. 2025-10-09 11:58:30 02860_distributed_flush_on_detach: [ OK ] 0.62 sec. 2025-10-09 11:58:30 00746_hashing_tuples: [ OK ] 0.72 sec. 2025-10-09 11:58:30 03151_pmj_join_non_procssed_clash: [ OK ] 0.72 sec. 2025-10-09 11:58:30 01115_join_with_dictionary: [ OK ] 1.48 sec. 2025-10-09 11:58:31 01214_test_storage_merge_aliases_with_where: [ OK ] 0.98 sec. 2025-10-09 11:58:31 01944_insert_partition_by: [ OK ] 0.92 sec. 2025-10-09 11:58:31 02560_tuple_format: [ OK ] 1.83 sec. 2025-10-09 11:58:32 03003_count_asterisk_filter: [ OK ] 0.57 sec. 2025-10-09 11:58:32 02122_parallel_formatting_JSONCompact: [ OK ] 4.73 sec. 2025-10-09 11:58:32 02302_projections_GROUP_BY_ORDERY_BY_optimize_aggregation_in_order: [ OK ] 0.67 sec. 2025-10-09 11:58:33 03032_variant_bool_number_not_suspicious: [ OK ] 0.52 sec. 2025-10-09 11:58:33 02241_parquet_bad_column: [ OK ] 6.09 sec. 2025-10-09 11:58:33 02008_materialize_column: [ OK ] 0.92 sec. 2025-10-09 11:58:33 03096_largest_triangle_3b_crash: [ OK ] 0.47 sec. 2025-10-09 11:58:33 00143_number_classification_functions: [ OK ] 0.72 sec. 2025-10-09 11:58:33 02703_jit_external_aggregation: [ SKIPPED ] 0.00 sec. 2025-10-09 11:58:33 Reason: not running for current build 2025-10-09 11:58:34 01865_aggregator_overflow_row: [ OK ] 0.77 sec. 2025-10-09 11:58:35 00978_ml_math: [ OK ] 0.52 sec. 2025-10-09 11:58:36 00940_order_by_read_in_order_query_plan: [ OK ] 2.43 sec. 2025-10-09 11:58:36 02480_client_option_print_num_processed_rows: [ OK ] 4.39 sec. 2025-10-09 11:58:36 01471_with_format: [ OK ] 0.52 sec. 2025-10-09 11:58:37 02266_protobuf_format_google_wrappers: [ OK ] 8.39 sec. 2025-10-09 11:58:37 00169_join_constant_keys: [ OK ] 0.52 sec. 2025-10-09 11:58:37 00483_reading_from_array_structure: [ OK ] 0.67 sec. 2025-10-09 11:58:38 02110_clickhouse_local_custom_tld: [ OK ] 1.78 sec. 2025-10-09 11:58:38 00799_function_dry_run: [ OK ] 0.57 sec. 2025-10-09 11:58:38 01032_cityHash64_for_decimal: [ OK ] 0.62 sec. 2025-10-09 11:58:39 02111_with_fill_no_rows: [ OK ] 0.57 sec. 2025-10-09 11:58:39 01249_flush_interactive: [ OK ] 11.50 sec. 2025-10-09 11:58:40 02946_literal_alias_misclassification: [ OK ] 0.62 sec. 2025-10-09 11:58:40 03210_optimize_rewrite_aggregate_function_with_if_return_type_bug: [ OK ] 0.77 sec. 2025-10-09 11:58:41 01945_system_warnings: [ OK ] 3.93 sec. 2025-10-09 11:58:41 00988_parallel_parts_removal: [ OK ] 6.59 sec. 2025-10-09 11:58:41 03046_column_in_block_array_join: [ OK ] 0.78 sec. 2025-10-09 11:58:42 02158_ztest_cmp: [ OK ] 2.78 sec. 2025-10-09 11:58:42 00321_pk_set: [ OK ] 0.72 sec. 2025-10-09 11:58:42 01666_date_lut_buffer_overflow: [ OK ] 0.57 sec. 2025-10-09 11:58:42 01326_build_id: [ OK ] 0.47 sec. 2025-10-09 11:58:42 00831_quantile_weighted_parameter_check: [ OK ] 0.57 sec. 2025-10-09 11:58:43 02876_json_incomplete_types_as_strings_inference: [ OK ] 0.62 sec. 2025-10-09 11:58:43 00191_aggregating_merge_tree_and_final: [ OK ] 0.62 sec. 2025-10-09 11:58:44 02047_log_family_data_file_sizes: [ OK ] 11.70 sec. 2025-10-09 11:58:44 02104_clickhouse_local_columns_description: [ OK ] 1.73 sec. 2025-10-09 11:58:44 00229_prewhere_column_missing: [ OK ] 0.87 sec. 2025-10-09 11:58:45 01710_projection_external_aggregate: [ OK ] 0.97 sec. 2025-10-09 11:58:45 01616_untuple_access_field: [ OK ] 0.52 sec. 2025-10-09 11:58:45 02869_unicode_minus: [ OK ] 0.52 sec. 2025-10-09 11:58:46 02513_prewhere_combine_step_filters: [ OK ] 0.77 sec. 2025-10-09 11:58:46 03164_analyzer_validate_tree_size: [ OK ] 1.17 sec. 2025-10-09 11:58:46 03157_dynamic_type_json: [ OK ] 0.62 sec. 2025-10-09 11:58:47 02771_skip_empty_files: [ OK ] 5.49 sec. 2025-10-09 11:58:47 02246_is_secure_query_log: [ OK ] 8.84 sec. 2025-10-09 11:58:47 01926_date_date_time_supertype: [ OK ] 0.83 sec. 2025-10-09 11:58:47 00062_replicated_merge_tree_alter_zookeeper_long: [ OK ] 2.43 sec. 2025-10-09 11:58:47 02408_to_fixed_string_short_circuit: [ OK ] 0.48 sec. 2025-10-09 11:58:47 02916_csv_infer_numbers_from_strings: [ OK ] 0.53 sec. 2025-10-09 11:58:47 02475_precise_decimal_arithmetics: [ OK ] 1.18 sec. 2025-10-09 11:58:48 01499_log_deadlock: [ OK ] 0.67 sec. 2025-10-09 11:58:48 02336_sort_optimization_with_fill: [ OK ] 0.47 sec. 2025-10-09 11:58:48 02809_has_token: [ OK ] 0.53 sec. 2025-10-09 11:58:48 02491_part_log_has_table_uuid: [ OK ] 1.23 sec. 2025-10-09 11:58:48 02481_xxh3_hash_function: [ OK ] 0.47 sec. 2025-10-09 11:58:49 00952_input_function: [ OK ] 15.91 sec. 2025-10-09 11:58:49 01880_remote_ipv6: [ OK ] 0.83 sec. 2025-10-09 11:58:49 00542_access_to_temporary_table_in_readonly_mode: [ OK ] 0.57 sec. 2025-10-09 11:58:49 01686_rocksdb: [ OK ] 0.92 sec. 2025-10-09 11:58:50 02133_final_prewhere_where_lowcardinality_replacing: [ OK ] 0.72 sec. 2025-10-09 11:58:50 00552_or_nullable: [ OK ] 0.72 sec. 2025-10-09 11:58:50 01513_count_without_select_sequence_consistency_zookeeper_long: [ OK ] 0.98 sec. 2025-10-09 11:58:50 03202_dynamic_null_map_subcolumn: [ OK ] 2.43 sec. 2025-10-09 11:58:50 02741_hashed_dictionary_load_factor: [ OK ] 2.18 sec. 2025-10-09 11:58:50 02053_INSERT_SELECT_MATERIALIZED: [ OK ] 0.52 sec. 2025-10-09 11:58:50 02789_functions_after_sorting_and_columns_with_same_names_bug_2: [ OK ] 0.62 sec. 2025-10-09 11:58:51 01492_array_join_crash_13829: [ OK ] 0.52 sec. 2025-10-09 11:58:51 02481_i43247_ubsan_in_minmaxany: [ OK ] 0.72 sec. 2025-10-09 11:58:51 00236_replicated_drop_on_non_leader_zookeeper_long: [ OK ] 0.72 sec. 2025-10-09 11:58:53 01279_empty_external_table: [ OK ] 3.08 sec. 2025-10-09 11:58:53 02809_has_subsequence: [ OK ] 1.59 sec. 2025-10-09 11:58:53 01951_distributed_push_down_limit: [ OK ] 0.69 sec. 2025-10-09 11:58:54 00978_sum_map_bugfix: [ OK ] 0.74 sec. 2025-10-09 11:58:54 00825_protobuf_format_array_3dim: [ OK ] 4.19 sec. 2025-10-09 11:58:55 00334_column_aggregate_function_limit: [ OK ] 0.74 sec. 2025-10-09 11:58:55 03038_nested_dynamic_merges_small: [ OK ] 4.73 sec. 2025-10-09 11:58:56 01012_serialize_array_memory_usage: [ OK ] 2.33 sec. 2025-10-09 11:58:56 02295_GROUP_BY_AggregateFunction: [ OK ] 1.18 sec. 2025-10-09 11:58:56 03217_filtering_in_storage_merge: [ OK ] 0.78 sec. 2025-10-09 11:58:57 00308_write_buffer_valid_utf8: [ OK ] 0.63 sec. 2025-10-09 11:58:57 01825_type_json_8: [ OK ] 5.96 sec. 2025-10-09 11:58:57 00712_nan_comparison: [ OK ] 1.05 sec. 2025-10-09 11:58:57 02582_async_reading_with_small_limit: [ OK ] 0.83 sec. 2025-10-09 11:58:57 01961_roaring_memory_tracking: [ SKIPPED ] 0.00 sec. 2025-10-09 11:58:57 Reason: not running for current build 2025-10-09 11:58:58 01940_point_in_polygon_ubsan: [ OK ] 0.67 sec. 2025-10-09 11:58:58 00910_decimal_group_array_crash_3783: [ OK ] 1.08 sec. 2025-10-09 11:58:58 01561_aggregate_functions_of_key_with_join: [ OK ] 0.78 sec. 2025-10-09 11:58:58 03258_old_analyzer_const_expr_bug: [ OK ] 0.69 sec. 2025-10-09 11:58:59 01853_s2_cells_intersect: [ OK ] 0.62 sec. 2025-10-09 11:58:59 00041_big_array_join: [ OK ] 0.98 sec. 2025-10-09 11:58:59 03169_display_column_names_in_footer: [ OK ] 0.93 sec. 2025-10-09 11:59:00 01783_merge_engine_join_key_condition: [ OK ] 0.98 sec. 2025-10-09 11:59:00 01937_nested_chinese: [ OK ] 0.63 sec. 2025-10-09 11:59:01 00898_parsing_bad_diagnostic_message: [ OK ] 2.13 sec. 2025-10-09 11:59:01 02354_vector_search_queries: [ OK ] 1.13 sec. 2025-10-09 11:59:02 02124_buffer_with_type_map_long: [ OK ] 12.91 sec. 2025-10-09 11:59:02 02883_read_in_reverse_order_virtual_column: [ OK ] 1.44 sec. 2025-10-09 11:59:02 00926_adaptive_index_granularity_merge_tree: [ OK ] 3.54 sec. 2025-10-09 11:59:03 00553_buff_exists_materlized_column: [ OK ] 0.62 sec. 2025-10-09 11:59:03 02025_subcolumns_compact_parts: [ OK ] 0.63 sec. 2025-10-09 11:59:03 02882_primary_key_index_in_function_different_types: [ OK ] 0.67 sec. 2025-10-09 11:59:04 02423_ddl_for_opentelemetry: [ OK ] 22.56 sec. 2025-10-09 11:59:04 01825_type_json_1: [ OK ] 0.92 sec. 2025-10-09 11:59:05 02894_ast_depth_check: [ OK ] 2.03 sec. 2025-10-09 11:59:05 02985_minmax_index_aggregate_function: [ OK ] 0.72 sec. 2025-10-09 11:59:06 00004_shard_format_ast_and_remote_table: [ OK ] 0.57 sec. 2025-10-09 11:59:06 01882_check_max_parts_to_merge_at_once: [ OK ] 1.88 sec. 2025-10-09 11:59:06 01683_intdiv_ubsan: [ OK ] 0.57 sec. 2025-10-09 11:59:06 01670_log_comment: [ OK ] 1.03 sec. 2025-10-09 11:59:07 02244_ip_address_invalid_insert: [ OK ] 1.03 sec. 2025-10-09 11:59:07 02179_bool_type: [ OK ] 1.03 sec. 2025-10-09 11:59:07 01825_type_json_schema_inference: [ OK ] 6.04 sec. 2025-10-09 11:59:08 02475_analysis_of_variance: [ OK ] 0.72 sec. 2025-10-09 11:59:08 03215_grant_current_grants: [ OK ] 5.64 sec. 2025-10-09 11:59:08 02764_index_analysis_fix: [ OK ] 0.57 sec. 2025-10-09 11:59:09 01634_sum_map_nulls: [ OK ] 0.67 sec. 2025-10-09 11:59:09 02910_replicated_merge_parameters_must_consistent: [ OK ] 1.12 sec. 2025-10-09 11:59:09 01825_type_json_partitions: [ OK ] 0.62 sec. 2025-10-09 11:59:10 00794_materialized_view_with_column_defaults: [ OK ] 0.62 sec. 2025-10-09 11:59:11 02050_clickhouse_local_parsing_exception: [ OK ] 1.72 sec. 2025-10-09 11:59:12 01544_file_engine_settings: [ OK ] 2.33 sec. 2025-10-09 11:59:13 00738_lock_for_inner_table: [ OK ] 4.59 sec. 2025-10-09 11:59:13 00972_geohashesInBox: [ OK ] 1.93 sec. 2025-10-09 11:59:13 03168_fuzz_multiIf_short_circuit: [ OK ] 0.52 sec. 2025-10-09 11:59:14 00752_low_cardinality_permute: [ OK ] 0.57 sec. 2025-10-09 11:59:14 01456_low_cardinality_sorting_bugfix: [ OK ] 0.77 sec. 2025-10-09 11:59:15 02884_string_distance_function: [ OK ] 1.43 sec. 2025-10-09 11:59:16 00224_shard_distributed_aggregation_memory_efficient_and_overflows: [ OK ] 1.08 sec. 2025-10-09 11:59:17 01122_totals_rollup_having_block_header: [ OK ] 0.72 sec. 2025-10-09 11:59:18 00826_cross_to_inner_join: [ OK ] 1.33 sec. 2025-10-09 11:59:19 03002_filter_skip_virtual_columns_with_non_deterministic_functions: [ OK ] 7.09 sec. 2025-10-09 11:59:21 02149_schema_inference: [ OK ] 27.62 sec. 2025-10-09 11:59:21 02498_storage_join_key_positions: [ OK ] 2.13 sec. 2025-10-09 11:59:22 01475_fix_bigint_shift: [ OK ] 0.52 sec. 2025-10-09 11:59:22 02316_values_table_func_bug: [ OK ] 0.52 sec. 2025-10-09 11:59:23 02524_fuzz_and_fuss: [ OK ] 0.57 sec. 2025-10-09 11:59:24 02130_parse_quoted_null: [ OK ] 9.80 sec. 2025-10-09 11:59:24 00284_external_aggregation_2: [ OK ] 16.47 sec. 2025-10-09 11:59:24 01770_extended_range_3: [ OK ] 0.57 sec. 2025-10-09 11:59:24 01678_great_circle_angle: [ OK ] 0.62 sec. 2025-10-09 11:59:25 02317_distinct_in_order_optimization_explain: [ OK ] 27.10 sec. 2025-10-09 11:59:25 03031_tuple_elimination_analyzer: [ OK ] 0.57 sec. 2025-10-09 11:59:25 01055_prewhere_bugs: [ OK ] 0.62 sec. 2025-10-09 11:59:25 03246_json_simd_rapid_parsers: [ OK ] 2.63 sec. 2025-10-09 11:59:26 02661_read_from_archive_zip: [ OK ] 19.33 sec. 2025-10-09 11:59:26 01656_sequence_next_node_long: [ OK ] 7.14 sec. 2025-10-09 11:59:26 00362_great_circle_distance: [ OK ] 0.68 sec. 2025-10-09 11:59:26 03246_json_tuple_decompress_race: [ OK ] 1.18 sec. 2025-10-09 11:59:27 02043_query_obfuscator_embedded_dictionaries: [ OK ] 1.63 sec. 2025-10-09 11:59:27 00666_uniq_complex_types: [ OK ] 1.03 sec. 2025-10-09 11:59:27 02515_and_or_if_multiif_not_return_lc: [ OK ] 0.52 sec. 2025-10-09 11:59:27 02126_url_auth: [ OK ] 2.13 sec. 2025-10-09 11:59:27 00227_quantiles_timing_arbitrary_order: [ OK ] 0.67 sec. 2025-10-09 11:59:27 02426_to_string_nullable_fixedstring: [ OK ] 0.57 sec. 2025-10-09 11:59:27 01771_datetime64_no_time_part: [ OK ] 0.67 sec. 2025-10-09 11:59:28 01333_select_abc_asterisk: [ OK ] 0.67 sec. 2025-10-09 11:59:28 02381_parseDateTime64BestEffortUS: [ OK ] 0.73 sec. 2025-10-09 11:59:28 03010_sum_to_to_count_if_nullable: [ OK ] 0.92 sec. 2025-10-09 11:59:29 00809_add_days_segfault: [ OK ] 0.83 sec. 2025-10-09 11:59:29 01290_max_execution_speed_distributed: [ OK ] 4.23 sec. 2025-10-09 11:59:30 01710_projection_optimize_materialize: [ OK ] 2.09 sec. 2025-10-09 11:59:31 03208_numbers_total_rows_approx: [ OK ] 0.53 sec. 2025-10-09 11:59:31 02122_parallel_formatting_TSVWithNames: [ OK ] 4.63 sec. 2025-10-09 11:59:31 03212_max_bytes_to_read_for_schema_inference_in_cache: [ OK ] 1.93 sec. 2025-10-09 11:59:32 01323_add_scalars_in_time: [ OK ] 0.95 sec. 2025-10-09 11:59:32 01769_extended_range_2: [ OK ] 0.73 sec. 2025-10-09 11:59:32 01785_parallel_formatting_memory: [ OK ] 3.79 sec. 2025-10-09 11:59:32 01868_order_by_fill_with_datetime64: [ OK ] 0.58 sec. 2025-10-09 11:59:33 02798_explain_settings_not_applied_bug: [ OK ] 0.58 sec. 2025-10-09 11:59:33 01356_state_resample: [ OK ] 0.72 sec. 2025-10-09 11:59:33 03144_alter_column_and_read: [ OK ] 0.68 sec. 2025-10-09 11:59:33 02003_WithMergeableStateAfterAggregationAndLimit_LIMIT_BY_LIMIT_OFFSET: [ OK ] 0.78 sec. 2025-10-09 11:59:33 00951_ngram_search: [ OK ] 4.04 sec. 2025-10-09 11:59:34 02783_parsedatetimebesteffort_syslog: [ OK ] 0.73 sec. 2025-10-09 11:59:34 02481_async_insert_dedup_token: [ OK ] 92.42 sec. 2025-10-09 11:59:34 02783_parallel_replicas_trivial_count_optimization: [ OK ] 7.54 sec. 2025-10-09 11:59:34 02575_merge_prewhere_default_expression: [ OK ] 0.77 sec. 2025-10-09 11:59:34 02367_analyzer_table_alias_columns: [ OK ] 1.29 sec. 2025-10-09 11:59:34 02863_mutation_where_in_set_result_cache_pipeline_stuck_bug: [ OK ] 0.92 sec. 2025-10-09 11:59:35 02699_polygons_sym_difference_total: [ OK ] 0.58 sec. 2025-10-09 11:59:35 03008_deduplication_insert_into_partitioned_table: [ OK ] 2.18 sec. 2025-10-09 11:59:35 00277_array_filter: [ OK ] 0.62 sec. 2025-10-09 11:59:35 02013_emptystring_cast: [ OK ] 0.93 sec. 2025-10-09 11:59:35 00228_shard_quantiles_deterministic_merge_overflow: [ OK ] 0.77 sec. 2025-10-09 11:59:36 01656_ipv4_bad_formatting: [ OK ] 0.63 sec. 2025-10-09 11:59:36 01458_is_decimal_overflow: [ OK ] 0.98 sec. 2025-10-09 11:59:36 02151_client_option_echo: [ OK ] 3.38 sec. 2025-10-09 11:59:36 01201_drop_column_compact_part_replicated_zookeeper_long: [ OK ] 1.84 sec. 2025-10-09 11:59:36 01305_polygons_union: [ OK ] 1.03 sec. 2025-10-09 11:59:36 00409_shard_limit_by: [ OK ] 1.13 sec. 2025-10-09 11:59:36 01703_rewrite_aggregate_function_case_insensitive: [ OK ] 0.58 sec. 2025-10-09 11:59:37 01633_limit_fuzz: [ OK ] 0.57 sec. 2025-10-09 11:59:37 02968_mysql_prefer_column_name_to_alias: [ OK ] 1.63 sec. 2025-10-09 11:59:37 00320_between: [ OK ] 0.58 sec. 2025-10-09 11:59:37 01774_bar_with_illegal_value: [ OK ] 0.63 sec. 2025-10-09 11:59:37 01685_json_extract_double_as_float: [ OK ] 0.62 sec. 2025-10-09 11:59:37 00612_count: [ OK ] 1.18 sec. 2025-10-09 11:59:38 00810_in_operators_segfault: [ OK ] 0.57 sec. 2025-10-09 11:59:38 03165_storage_merge_view_prewhere: [ OK ] 0.88 sec. 2025-10-09 11:59:38 01353_nullable_tuple: [ OK ] 2.13 sec. 2025-10-09 11:59:38 01085_datetime_arithmetic_preserve_timezone: [ OK ] 0.53 sec. 2025-10-09 11:59:38 01293_show_settings: [ OK ] 0.32 sec. 2025-10-09 11:59:38 02887_tuple_element_distributed: [ OK ] 0.52 sec. 2025-10-09 11:59:38 02701_invalid_having_NOT_AN_AGGREGATE: [ OK ] 0.58 sec. 2025-10-09 11:59:39 02478_analyzer_table_expression_aliases: [ OK ] 0.97 sec. 2025-10-09 11:59:39 02381_join_dup_columns_in_plan: [ OK ] 1.18 sec. 2025-10-09 11:59:39 03068_analyzer_distributed_join: [ OK ] 1.13 sec. 2025-10-09 11:59:40 00999_nullable_nested_types_4877: [ OK ] 1.02 sec. 2025-10-09 11:59:40 02705_projection_and_ast_optimizations_bug: [ OK ] 0.72 sec. 2025-10-09 11:59:40 00605_intersections_aggregate_functions: [ OK ] 0.73 sec. 2025-10-09 11:59:41 02150_index_hypothesis_race_long: [ OK ] 18.92 sec. 2025-10-09 11:59:41 02734_sparse_columns_short_circuit: [ OK ] 0.78 sec. 2025-10-09 11:59:42 01710_projection_with_ast_rewrite_settings: [ OK ] 0.83 sec. 2025-10-09 11:59:42 00612_union_query_with_subquery: [ OK ] 0.63 sec. 2025-10-09 11:59:42 03171_direct_dict_short_circuit_bug: [ OK ] 0.67 sec. 2025-10-09 11:59:43 02567_native_type_conversions: [ OK ] 3.28 sec. 2025-10-09 11:59:43 02708_dotProduct: [ OK ] 1.52 sec. 2025-10-09 11:59:43 02353_translate: [ OK ] 0.72 sec. 2025-10-09 11:59:44 02517_infer_uint64_in_case_of_int64_overflow: [ OK ] 5.29 sec. 2025-10-09 11:59:44 01596_setting_limit_offset: [ OK ] 0.92 sec. 2025-10-09 11:59:44 02416_rocksdb_delete_update: [ OK ] 0.87 sec. 2025-10-09 11:59:44 02988_ordinary_database_warning: [ OK ] 0.57 sec. 2025-10-09 11:59:44 02908_Npy_files_caching: [ OK ] 3.93 sec. 2025-10-09 11:59:44 01825_type_json_5: [ OK ] 0.62 sec. 2025-10-09 11:59:45 00980_crash_nullable_decimal: [ OK ] 0.62 sec. 2025-10-09 11:59:45 03115_alias_exists_column: [ OK ] 0.52 sec. 2025-10-09 11:59:45 01409_topK_merge: [ OK ] 0.77 sec. 2025-10-09 11:59:45 00048_b_stored_aggregates_merge: [ OK ] 0.72 sec. 2025-10-09 11:59:45 02592_avro_records_with_same_names: [ OK ] 1.93 sec. 2025-10-09 11:59:45 02504_regexp_dictionary_ua_parser: [ OK ] 8.39 sec. 2025-10-09 11:59:46 01278_variance_nonnegative: [ OK ] 0.82 sec. 2025-10-09 11:59:46 02771_jit_functions_comparison_crash: [ OK ] 0.62 sec. 2025-10-09 11:59:46 02136_scalar_progress: [ OK ] 1.58 sec. 2025-10-09 11:59:46 00900_orc_arrow_parquet_tuples: [ OK ] 9.65 sec. 2025-10-09 11:59:46 00860_unknown_identifier_bug: [ OK ] 0.57 sec. 2025-10-09 11:59:46 02015_async_inserts_4: [ OK ] 9.50 sec. 2025-10-09 11:59:47 03022_alter_materialized_view_query_has_inner_table: [ OK ] 0.67 sec. 2025-10-09 11:59:47 01622_constraints_simple_optimization: [ OK ] 1.83 sec. 2025-10-09 11:59:47 01585_fuzz_bits_with_bugfix: [ OK ] 0.52 sec. 2025-10-09 11:59:47 01542_collate_in_array: [ OK ] 0.72 sec. 2025-10-09 11:59:47 02131_row_policies_combination: [ OK ] 0.92 sec. 2025-10-09 11:59:47 01147_partial_merge_full_join: [ OK ] 2.48 sec. 2025-10-09 11:59:48 01762_deltasumtimestamp: [ OK ] 0.67 sec. 2025-10-09 11:59:48 01476_right_full_join_switch: [ OK ] 0.97 sec. 2025-10-09 11:59:48 01050_engine_join_crash: [ OK ] 0.87 sec. 2025-10-09 11:59:48 02383_array_signed_const_positive_index: [ OK ] 0.77 sec. 2025-10-09 11:59:48 02458_key_condition_not_like_prefix: [ OK ] 0.72 sec. 2025-10-09 11:59:48 00172_constexprs_in_set: [ OK ] 0.57 sec. 2025-10-09 11:59:48 02158_proportions_ztest: [ OK ] 0.62 sec. 2025-10-09 11:59:49 01230_join_get_truncate: [ OK ] 0.62 sec. 2025-10-09 11:59:49 03098_prefer_column_to_alias_subquery: [ OK ] 0.97 sec. 2025-10-09 11:59:49 01045_bloom_filter_null_array: [ OK ] 0.67 sec. 2025-10-09 11:59:49 03135_keeper_client_find_commands: [ OK ] 3.23 sec. 2025-10-09 11:59:49 03014_analyzer_groupby_fuzz_60317: [ OK ] 0.57 sec. 2025-10-09 11:59:50 02812_subquery_operators: [ OK ] 0.67 sec. 2025-10-09 11:59:50 01652_ttl_old_syntax: [ OK ] 0.57 sec. 2025-10-09 11:59:51 02141_clickhouse_local_interactive_table: [ OK ] 2.23 sec. 2025-10-09 11:59:51 03152_analyzer_columns_list: [ OK ] 0.77 sec. 2025-10-09 11:59:51 02400_memory_accounting_on_error: [ OK ] 1.73 sec. 2025-10-09 11:59:51 01251_string_comparison: [ OK ] 0.52 sec. 2025-10-09 11:59:52 02932_query_settings_max_size_drop: [ OK ] 0.77 sec. 2025-10-09 11:59:52 02915_analyzer_fuzz_1: [ OK ] 0.52 sec. 2025-10-09 11:59:52 00002_system_numbers: [ OK ] 0.62 sec. 2025-10-09 11:59:52 02025_nested_func_for_if_combinator: [ OK ] 0.67 sec. 2025-10-09 11:59:52 00160_merge_and_index_in_in: [ OK ] 7.39 sec. 2025-10-09 11:59:54 00688_low_cardinality_serialization: [ OK ] 4.24 sec. 2025-10-09 11:59:54 02477_invalid_reads: [ OK ] 1.58 sec. 2025-10-09 11:59:54 01318_encrypt: [ OK ] 2.13 sec. 2025-10-09 11:59:54 00836_indices_alter_replicated_zookeeper_long: [ OK ] 1.83 sec. 2025-10-09 11:59:54 01891_partition_by_uuid: [ OK ] 0.52 sec. 2025-10-09 11:59:55 02426_pod_array_overflow_2: [ OK ] 0.57 sec. 2025-10-09 11:59:55 00851_http_insert_json_defaults: [ OK ] 3.33 sec. 2025-10-09 11:59:55 00661_optimize_final_replicated_without_partition_zookeeper: [ OK ] 0.88 sec. 2025-10-09 11:59:55 00180_attach_materialized_view: [ OK ] 0.52 sec. 2025-10-09 11:59:55 02900_window_function_with_sparse_column: [ OK ] 0.62 sec. 2025-10-09 11:59:56 02725_object_column_alter: [ OK ] 0.52 sec. 2025-10-09 11:59:56 01070_h3_to_parent: [ OK ] 0.53 sec. 2025-10-09 11:59:56 01746_extract_text_from_html: [ OK ] 0.98 sec. 2025-10-09 11:59:57 00607_index_in_in: [ OK ] 0.67 sec. 2025-10-09 11:59:57 02178_column_function_insert_from: [ OK ] 0.57 sec. 2025-10-09 11:59:58 01288_shard_max_network_bandwidth: [ OK ] 3.08 sec. 2025-10-09 11:59:58 02551_obfuscator_keywords: [ OK ] 1.93 sec. 2025-10-09 11:59:58 02181_dictionary_attach_detach: [ OK ] 0.82 sec. 2025-10-09 11:59:58 00545_weird_aggregate_functions: [ OK ] 0.52 sec. 2025-10-09 11:59:58 02834_formats_with_variable_number_of_columns: [ OK ] 0.72 sec. 2025-10-09 11:59:59 01107_tuples_arrays_parsing_exceptions: [ OK ] 2.33 sec. 2025-10-09 11:59:59 03161_decimal_binary_math: [ OK ] 1.43 sec. 2025-10-09 11:59:59 02503_in_lc_const_args_bug: [ OK ] 0.52 sec. 2025-10-09 11:59:59 00950_default_prewhere: [ OK ] 0.77 sec. 2025-10-09 12:00:00 01592_length_map: [ OK ] 0.62 sec. 2025-10-09 12:00:00 01932_global_in_function: [ OK ] 0.62 sec. 2025-10-09 12:00:00 02725_any_join_single_row: [ OK ] 0.87 sec. 2025-10-09 12:00:00 02995_index_3: [ SKIPPED ] 0.00 sec. 2025-10-09 12:00:00 Reason: not running for current build 2025-10-09 12:00:00 01103_check_cpu_instructions_at_startup: [ SKIPPED ] 0.00 sec. 2025-10-09 12:00:00 Reason: not running for current build 2025-10-09 12:00:01 02493_analyzer_table_functions_untuple: [ OK ] 0.87 sec. 2025-10-09 12:00:01 00804_test_alter_compression_codecs: [ OK ] 13.61 sec. 2025-10-09 12:00:01 01502_bar_overflow: [ OK ] 1.48 sec. 2025-10-09 12:00:01 00610_materialized_view_forward_alter_partition_statements: [ OK ] 0.68 sec. 2025-10-09 12:00:02 03199_join_with_materialized_column: [ OK ] 0.57 sec. 2025-10-09 12:00:02 01015_empty_in_inner_right_join: [ OK ] 1.38 sec. 2025-10-09 12:00:03 00432_aggregate_function_scalars_and_constants: [ OK ] 1.18 sec. 2025-10-09 12:00:03 03208_inconsistent_formatting_of_not_subquery: [ OK ] 1.68 sec. 2025-10-09 12:00:04 00954_client_prepared_statements: [ OK ] 10.15 sec. 2025-10-09 12:00:05 02981_vertical_merges_memory_usage: [ OK ] 5.54 sec. 2025-10-09 12:00:05 02380_insert_mv_race: [ OK ] 5.14 sec. 2025-10-09 12:00:05 01018_ddl_dictionaries_select: [ OK ] 2.39 sec. 2025-10-09 12:00:06 02469_interval_msan: [ OK ] 0.82 sec. 2025-10-09 12:00:06 03041_recursive_cte_postgres_7: [ OK ] 1.28 sec. 2025-10-09 12:00:06 03150_url_hash_non_constant_level: [ OK ] 0.63 sec. 2025-10-09 12:00:06 01958_partial_hour_timezone: [ OK ] 0.57 sec. 2025-10-09 12:00:07 01497_now_support_timezone: [ OK ] 0.52 sec. 2025-10-09 12:00:07 01825_type_json_missed_values: [ OK ] 0.78 sec. 2025-10-09 12:00:08 02481_low_cardinality_with_short_circuit_functins: [ OK ] 0.83 sec. 2025-10-09 12:00:08 01274_generate_random_nested: [ OK ] 1.63 sec. 2025-10-09 12:00:09 03011_adaptative_timeout_compatibility: [ OK ] 0.58 sec. 2025-10-09 12:00:09 00462_json_true_false_literals: [ OK ] 0.57 sec. 2025-10-09 12:00:09 00148_summing_merge_tree_aggregate_function: [ OK ] 4.69 sec. 2025-10-09 12:00:10 03039_unknown_identifier_window_function: [ OK ] 0.57 sec. 2025-10-09 12:00:10 02319_sql_standard_create_drop_index: [ OK ] 0.97 sec. 2025-10-09 12:00:11 01273_h3EdgeAngle_range_check: [ OK ] 0.73 sec. 2025-10-09 12:00:11 03250_SYSTEM_DROP_FORMAT_SCHEMA_CACHE_FOR_Protobuf: [ OK ] 22.38 sec. 2025-10-09 12:00:11 02369_analyzer_array_join_function: [ OK ] 0.88 sec. 2025-10-09 12:00:12 02721_parquet_field_not_found: [ OK ] 2.18 sec. 2025-10-09 12:00:13 01032_cityHash64_for_UUID: [ OK ] 0.67 sec. 2025-10-09 12:00:13 02407_array_element_from_map_wrong_type: [ OK ] 0.52 sec. 2025-10-09 12:00:15 02457_csv_parse_date_out_of_range: [ OK ] 4.03 sec. 2025-10-09 12:00:15 01605_skip_idx_compact_parts: [ OK ] 0.77 sec. 2025-10-09 12:00:16 01710_aggregate_projection_with_monotonic_key_expr: [ OK ] 0.98 sec. 2025-10-09 12:00:17 01550_type_map_formats_input: [ OK ] 8.24 sec. 2025-10-09 12:00:17 02973_dictionary_table_exception_fix: [ OK ] 0.62 sec. 2025-10-09 12:00:18 00394_new_nested_column_keeps_offsets: [ OK ] 0.78 sec. 2025-10-09 12:00:18 02006_todatetime64_from_string: [ OK ] 0.57 sec. 2025-10-09 12:00:18 02192_comment: [ OK ] 0.57 sec. 2025-10-09 12:00:19 01780_column_sparse_tuple: [ OK ] 0.97 sec. 2025-10-09 12:00:19 00464_array_element_out_of_range: [ OK ] 0.57 sec. 2025-10-09 12:00:19 02514_bad_index_granularity: [ OK ] 0.52 sec. 2025-10-09 12:00:19 02337_check_translate_qualified_names_matcher: [ OK ] 0.57 sec. 2025-10-09 12:00:20 03146_bug47862: [ OK ] 0.57 sec. 2025-10-09 12:00:20 01710_projection_array_join: [ OK ] 0.62 sec. 2025-10-09 12:00:21 00048_a_stored_aggregates_merge: [ OK ] 0.82 sec. 2025-10-09 12:00:21 02052_last_granula_adjust_logical_error: [ OK ] 1.38 sec. 2025-10-09 12:00:21 02895_npy_format: [ OK ] 19.03 sec. 2025-10-09 12:00:21 00151_tuple_with_array: [ OK ] 0.52 sec. 2025-10-09 12:00:22 02014_map_different_keys: [ OK ] 0.77 sec. 2025-10-09 12:00:23 02346_read_in_order_fixed_prefix: [ OK ] 16.47 sec. 2025-10-09 12:00:23 02494_parser_string_binary_literal: [ OK ] 0.72 sec. 2025-10-09 12:00:24 00980_merge_alter_settings: [ OK ] 1.07 sec. 2025-10-09 12:00:24 03217_primary_index_memory_leak: [ SKIPPED ] 0.00 sec. 2025-10-09 12:00:24 Reason: not running for current build 2025-10-09 12:00:24 02864_statistics_ddl: [ OK ] 2.93 sec. 2025-10-09 12:00:24 02125_lz4_compression_bug_Values: [ OK ] 10.95 sec. 2025-10-09 12:00:24 02275_full_sort_join_long: [ SKIPPED ] 0.00 sec. 2025-10-09 12:00:24 Reason: not running for current build 2025-10-09 12:00:24 00940_max_parts_in_total: [ OK ] 0.67 sec. 2025-10-09 12:00:24 02360_send_logs_level_colors: [ OK ] 2.83 sec. 2025-10-09 12:00:25 02243_in_ip_address: [ OK ] 0.57 sec. 2025-10-09 12:00:25 03215_parsing_archive_name_s3: [ OK ] 0.92 sec. 2025-10-09 12:00:25 03222_datetime64_small_value_const: [ OK ] 1.28 sec. 2025-10-09 12:00:26 01017_in_unconvertible_complex_type: [ OK ] 0.73 sec. 2025-10-09 12:00:26 01710_projection_optimize_group_by_function_keys: [ OK ] 0.67 sec. 2025-10-09 12:00:26 02427_mutate_and_zero_copy_replication_zookeeper: [ OK ] 0.92 sec. 2025-10-09 12:00:27 02374_analyzer_array_join: [ OK ] 0.97 sec. 2025-10-09 12:00:27 00159_whitespace_in_columns_list: [ OK ] 0.62 sec. 2025-10-09 12:00:27 00909_arrayEnumerateUniq: [ OK ] 4.18 sec. 2025-10-09 12:00:27 02995_preliminary_filters_duplicated_columns: [ OK ] 0.58 sec. 2025-10-09 12:00:27 00952_insert_into_distributed_with_materialized_column: [ OK ] 1.38 sec. 2025-10-09 12:00:28 00373_group_by_tuple: [ OK ] 0.57 sec. 2025-10-09 12:00:28 02466_distributed_query_profiler: [ OK ] 1.38 sec. 2025-10-09 12:00:29 03148_setting_max_streams_to_max_threads_ratio_overflow: [ OK ] 0.67 sec. 2025-10-09 12:00:29 02181_format_describe_query: [ OK ] 1.83 sec. 2025-10-09 12:00:29 02125_dict_get_type_nullable_fix: [ OK ] 0.67 sec. 2025-10-09 12:00:30 01890_jit_aggregation_function_sum_long: [ OK ] 2.43 sec. 2025-10-09 12:00:30 01592_toUnixTimestamp_Date: [ OK ] 0.52 sec. 2025-10-09 12:00:30 01073_show_tables_not_like: [ OK ] 0.82 sec. 2025-10-09 12:00:31 01821_to_date_time_ubsan: [ OK ] 0.57 sec. 2025-10-09 12:00:32 00751_low_cardinality_nullable_group_by: [ OK ] 2.33 sec. 2025-10-09 12:00:33 01825_new_type_json_bools: [ OK ] 0.73 sec. 2025-10-09 12:00:34 00223_shard_distributed_aggregation_memory_efficient: [ OK ] 9.65 sec. 2025-10-09 12:00:34 00652_mutations_alter_update: [ OK ] 22.83 sec. 2025-10-09 12:00:35 02125_fix_storage_filelog: [ OK ] 0.63 sec. 2025-10-09 12:00:35 01882_total_rows_approx: [ OK ] 4.38 sec. 2025-10-09 12:00:36 02999_variant_suspicious_types: [ OK ] 0.78 sec. 2025-10-09 12:00:38 00540_bad_data_types: [ OK ] 10.00 sec. 2025-10-09 12:00:47 00900_orc_arrow_parquet_maps: [ OK ] 13.67 sec. 2025-10-09 12:00:54 02935_http_content_type_with_http_headers_progress: [ OK ] 17.63 sec. 2025-10-09 12:00:54 01825_type_json_in_array: [ OK ] 7.20 sec. 2025-10-09 12:00:55 03105_table_aliases_in_mv: [ OK ] 0.84 sec. 2025-10-09 12:00:56 01632_max_partitions_to_read: [ OK ] 0.98 sec. 2025-10-09 12:00:56 02455_default_union_except_intersect: [ OK ] 1.99 sec. 2025-10-09 12:00:57 00916_add_materialized_column_after: [ OK ] 0.64 sec. 2025-10-09 12:00:57 01053_if_chain_check: [ OK ] 1.14 sec. 2025-10-09 12:00:58 00738_nested_merge_multidimensional_array: [ OK ] 0.68 sec. 2025-10-09 12:00:58 02046_low_cardinality_parallel_group_by: [ OK ] 27.81 sec. 2025-10-09 12:00:58 02813_float_parsing: [ OK ] 0.53 sec. 2025-10-09 12:00:59 02019_multiple_weird_with_fill: [ OK ] 0.52 sec. 2025-10-09 12:00:59 01946_profile_sleep: [ OK ] 24.40 sec. 2025-10-09 12:00:59 02560_vertical_merge_memory_usage: [ OK ] 21.36 sec. 2025-10-09 12:01:00 01458_named_tuple_millin: [ OK ] 0.58 sec. 2025-10-09 12:01:00 01050_engine_join_view_crash: [ OK ] 0.67 sec. 2025-10-09 12:01:00 02538_alter_rename_sequence: [ OK ] 1.07 sec. 2025-10-09 12:01:00 02184_range_hashed_dictionary_outside_range_values: [ OK ] 0.63 sec. 2025-10-09 12:01:00 03031_clickhouse_local_input: [ OK ] 2.73 sec. 2025-10-09 12:01:01 02465_limit_trivial_max_rows_to_read: [ OK ] 0.62 sec. 2025-10-09 12:01:01 01383_log_broken_table: [ OK ] 57.89 sec. 2025-10-09 12:01:01 01034_prewhere_max_parallel_replicas_distributed: [ OK ] 0.68 sec. 2025-10-09 12:01:02 03036_reading_s3_archives: [ OK ] 1.73 sec. 2025-10-09 12:01:02 00503_cast_const_nullable: [ OK ] 0.52 sec. 2025-10-09 12:01:02 00680_duplicate_columns_inside_union_all: [ OK ] 0.57 sec. 2025-10-09 12:01:03 01293_pretty_max_value_width: [ OK ] 0.87 sec. 2025-10-09 12:01:03 03262_udf_in_constraint: [ OK ] 1.98 sec. 2025-10-09 12:01:04 01088_array_slice_of_aggregate_functions: [ OK ] 0.52 sec. 2025-10-09 12:01:04 03009_format_show_database: [ OK ] 2.28 sec. 2025-10-09 12:01:05 00752_low_cardinality_left_array_join: [ OK ] 0.77 sec. 2025-10-09 12:01:05 00825_http_header_query_id: [ OK ] 1.53 sec. 2025-10-09 12:01:05 02841_group_array_sorted: [ OK ] 1.43 sec. 2025-10-09 12:01:05 02868_select_support_from_keywords: [ OK ] 0.47 sec. 2025-10-09 12:01:05 01662_test_toDayOfMonth_mysql_compatibility: [ OK ] 0.57 sec. 2025-10-09 12:01:05 02122_parallel_formatting_JSON: [ OK ] 5.13 sec. 2025-10-09 12:01:06 01079_order_by_pk: [ OK ] 31.36 sec. 2025-10-09 12:01:06 03064_analyzer_named_subqueries: [ OK ] 0.58 sec. 2025-10-09 12:01:06 00558_parse_floats: [ OK ] 0.53 sec. 2025-10-09 12:01:06 02160_h3_cell_area_m2: [ OK ] 0.73 sec. 2025-10-09 12:01:07 01323_redundant_functions_in_order_by: [ OK ] 1.43 sec. 2025-10-09 12:01:07 02811_primary_key_in_columns: [ OK ] 1.07 sec. 2025-10-09 12:01:07 02998_projection_after_attach_partition: [ OK ] 0.83 sec. 2025-10-09 12:01:08 00230_array_functions_has_count_equal_index_of_non_const_second_arg: [ OK ] 0.92 sec. 2025-10-09 12:01:08 02041_test_fuzzy_alter: [ OK ] 0.62 sec. 2025-10-09 12:01:09 02891_functions_over_sparse_columns: [ OK ] 0.52 sec. 2025-10-09 12:01:10 02242_case_insensitive_column_matching: [ OK ] 8.80 sec. 2025-10-09 12:01:10 01460_line_as_string_format: [ OK ] 13.82 sec. 2025-10-09 12:01:11 03215_parquet_index: [ OK ] 0.67 sec. 2025-10-09 12:01:12 01560_DateTime_and_DateTime64_comparision: [ OK ] 0.58 sec. 2025-10-09 12:01:13 01890_state_of_state: [ OK ] 1.08 sec. 2025-10-09 12:01:13 03065_analyzer_cross_join_and_array_join: [ OK ] 0.47 sec. 2025-10-09 12:01:14 03142_alter_comment_parameterized_view: [ OK ] 0.57 sec. 2025-10-09 12:01:14 01170_alter_partition_isolation: [ OK ] 7.24 sec. 2025-10-09 12:01:15 00098_k_union_all: [ OK ] 0.52 sec. 2025-10-09 12:01:15 02968_full_sorting_join_fuzz: [ OK ] 9.00 sec. 2025-10-09 12:01:15 00402_nan_and_extremes: [ OK ] 0.68 sec. 2025-10-09 12:01:16 01513_optimize_aggregation_in_order_memory_long: [ OK ] 9.21 sec. 2025-10-09 12:01:17 00077_set_keys_fit_128_bits_many_blocks: [ OK ] 0.52 sec. 2025-10-09 12:01:18 02482_value_block_parsing: [ OK ] 2.23 sec. 2025-10-09 12:01:18 02907_read_buffer_content_is_cached_multiple_blobs: [ OK ] 1.08 sec. 2025-10-09 12:01:19 02766_bitshift_with_const_arguments: [ OK ] 0.88 sec. 2025-10-09 12:01:19 03012_parser_backtracking: [ OK ] 13.66 sec. 2025-10-09 12:01:19 02833_local_udf_options: [ OK ] 1.88 sec. 2025-10-09 12:01:20 03261_json_hints_types_check: [ OK ] 0.97 sec. 2025-10-09 12:01:21 00195_shard_union_all_and_global_in: [ OK ] 0.73 sec. 2025-10-09 12:01:21 01272_offset_without_limit: [ OK ] 0.68 sec. 2025-10-09 12:01:22 00443_optimize_final_vertical_merge: [ OK ] 12.93 sec. 2025-10-09 12:01:22 01773_datetime64_add_ubsan: [ OK ] 0.62 sec. 2025-10-09 12:01:23 02353_isnullable: [ OK ] 0.68 sec. 2025-10-09 12:01:24 02974_backup_query_format_null: [ OK ] 4.30 sec. 2025-10-09 12:01:24 01523_client_local_queries_file_parameter: [ OK ] 4.50 sec. 2025-10-09 12:01:24 01089_alter_settings_old_format: [ OK ] 0.58 sec. 2025-10-09 12:01:25 02007_join_use_nulls: [ OK ] 0.68 sec. 2025-10-09 12:01:25 01531_query_log_query_comment: [ OK ] 2.89 sec. 2025-10-09 12:01:25 00745_compile_scalar_subquery: [ OK ] 0.68 sec. 2025-10-09 12:01:26 01301_polygons_within: [ OK ] 0.78 sec. 2025-10-09 12:01:26 02494_array_function_range: [ OK ] 0.72 sec. 2025-10-09 12:01:26 03038_nested_dynamic_merges_wide_vertical: [ SKIPPED ] 0.00 sec. 2025-10-09 12:01:26 Reason: not running for current build 2025-10-09 12:01:26 00942_dataparts_500: [ OK ] 1.58 sec. 2025-10-09 12:01:27 02918_gorilla_invalid_file: [ OK ] 1.63 sec. 2025-10-09 12:01:27 03145_unicode_quotes: [ OK ] 0.53 sec. 2025-10-09 12:01:28 01632_tinylog_read_write: [ OK ] 12.66 sec. 2025-10-09 12:01:28 02784_move_all_conditions_to_prewhere_analyzer_asan: [ OK ] 0.63 sec. 2025-10-09 12:01:28 01550_mutation_subquery: [ OK ] 0.67 sec. 2025-10-09 12:01:29 00732_decimal_summing_merge_tree: [ OK ] 0.72 sec. 2025-10-09 12:01:30 01056_prepared_statements_null_and_escaping: [ OK ] 1.73 sec. 2025-10-09 12:01:30 00857_global_joinsavel_table_alias: [ OK ] 1.18 sec. 2025-10-09 12:01:31 02870_per_column_settings: [ OK ] 0.97 sec. 2025-10-09 12:01:31 03209_json_type_merges_small: [ SKIPPED ] 0.00 sec. 2025-10-09 12:01:31 Reason: not running for current build 2025-10-09 12:01:31 01654_test_writer_block_sequence: [ OK ] 16.73 sec. 2025-10-09 12:01:31 02982_unambiguous_alter_commands: [ OK ] 0.67 sec. 2025-10-09 12:01:31 02714_async_inserts_empty_data: [ OK ] 4.99 sec. 2025-10-09 12:01:31 02751_multiif_to_if_crash: [ OK ] 0.62 sec. 2025-10-09 12:01:32 01039_mergetree_exec_time: [ OK ] 1.63 sec. 2025-10-09 12:01:32 02422_read_numbers_as_strings: [ OK ] 0.52 sec. 2025-10-09 12:01:32 00358_from_string_complex_types: [ OK ] 0.57 sec. 2025-10-09 12:01:33 02149_schema_inference_create_table_syntax: [ OK ] 10.47 sec. 2025-10-09 12:01:33 01927_query_views_log_current_database: [ OK ] 1.88 sec. 2025-10-09 12:01:34 02345_analyzer_subqueries: [ OK ] 0.82 sec. 2025-10-09 12:01:34 02970_visible_width_behavior: [ OK ] 0.67 sec. 2025-10-09 12:01:35 02481_async_insert_dedup: [ OK ] 106.14 sec. 2025-10-09 12:01:35 00717_merge_and_distributed: [ OK ] 2.78 sec. 2025-10-09 12:01:36 02531_two_level_aggregation_bug: [ OK ] 3.48 sec. 2025-10-09 12:01:36 02201_use_skip_indexes_if_final: [ OK ] 0.78 sec. 2025-10-09 12:01:36 02499_analyzer_set_index: [ OK ] 0.57 sec. 2025-10-09 12:01:36 01183_custom_separated_format_http: [ OK ] 4.53 sec. 2025-10-09 12:01:36 02310_generate_multi_columns_with_uuid: [ OK ] 0.58 sec. 2025-10-09 12:01:37 02346_fulltext_index_bug47393: [ OK ] 0.72 sec. 2025-10-09 12:01:37 02840_merge__table_or_filter: [ OK ] 1.08 sec. 2025-10-09 12:01:37 01196_max_parser_depth: [ OK ] 2.56 sec. 2025-10-09 12:01:37 02932_parallel_replicas_fuzzer: [ OK ] 0.78 sec. 2025-10-09 12:01:37 02841_join_filter_set_sparse: [ OK ] 0.88 sec. 2025-10-09 12:01:37 02968_analyzer_join_column_not_found: [ OK ] 0.57 sec. 2025-10-09 12:01:38 02950_part_log_bytes_uncompressed: [ OK ] 1.02 sec. 2025-10-09 12:01:38 01010_partial_merge_join_const_and_lc: [ OK ] 0.82 sec. 2025-10-09 12:01:38 02815_no_throw_in_simple_queries: [ FAIL ] 4.13 sec. 2025-10-09 12:01:38 Reason: return code: 1 2025-10-09 12:01:38 send: spawn id exp3 not open 2025-10-09 12:01:38 while executing 2025-10-09 12:01:38 "send -- "exit\r"" 2025-10-09 12:01:38 , result: 2025-10-09 12:01:38 2025-10-09 12:01:38 Failed 2025-10-09 12:01:38 Failed 2025-10-09 12:01:38 Failed 2025-10-09 12:01:38 Failed 2025-10-09 12:01:38 Failed 2025-10-09 12:01:38 Failed 2025-10-09 12:01:38 Failed 2025-10-09 12:01:38 Failed 2025-10-09 12:01:38 2025-10-09 12:01:38 stdout: 2025-10-09 12:01:38 Failed 2025-10-09 12:01:38 Failed 2025-10-09 12:01:38 Failed 2025-10-09 12:01:38 Failed 2025-10-09 12:01:38 Failed 2025-10-09 12:01:38 Failed 2025-10-09 12:01:38 Failed 2025-10-09 12:01:38 Failed 2025-10-09 12:01:38 2025-10-09 12:01:38 2025-10-09 12:01:38 Settings used in the test: --max_insert_threads 1 --group_by_two_level_threshold 1 --group_by_two_level_threshold_bytes 7437654 --distributed_aggregation_memory_efficient 0 --fsync_metadata 0 --output_format_parallel_formatting 1 --input_format_parallel_parsing 1 --min_chunk_bytes_for_parallel_parsing 6493098 --max_read_buffer_size 706103 --prefer_localhost_replica 1 --max_block_size 97891 --max_joined_block_size_rows 61166 --max_threads 32 --optimize_append_index 1 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 1 --optimize_read_in_order 1 --optimize_or_like_chain 0 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 0 --read_in_order_two_level_merge_threshold 68 --optimize_aggregation_in_order 1 --aggregation_in_order_max_block_bytes 41595024 --use_uncompressed_cache 0 --min_bytes_to_use_direct_io 1 --min_bytes_to_use_mmap_io 4312182898 --local_filesystem_read_method io_uring --remote_filesystem_read_method threadpool --local_filesystem_read_prefetch 0 --filesystem_cache_segments_batch_size 10 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 1 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 32Mi --filesystem_prefetches_limit 0 --filesystem_prefetch_min_bytes_for_single_read_task 16Mi --filesystem_prefetch_step_marks 50 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 1 --compile_sort_description 1 --merge_tree_coarse_index_granularity 13 --optimize_distinct_in_order 1 --max_bytes_before_external_sort 10737418240 --max_bytes_before_external_group_by 5465850280 --max_bytes_before_remerge_sort 298953686 --min_compress_block_size 586241 --max_compress_block_size 865656 --merge_tree_compact_parts_min_granules_to_multibuffer_read 111 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 9952079 --http_wait_end_of_query True --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 3 --min_count_to_compile_sort_description 0 --session_timezone Africa/Khartoum --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction False --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.8 --prefer_external_sort_block_bytes 100000000 --cross_join_min_rows_to_compress 100000000 --cross_join_min_bytes_to_compress 0 --min_external_table_block_size_bytes 0 --max_parsing_threads 10 --optimize_functions_to_subcolumns 0 --parallel_replicas_local_plan 0 2025-10-09 12:01:38 2025-10-09 12:01:38 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 0.0 --prefer_fetch_merged_part_size_threshold 10737418240 --vertical_merge_algorithm_min_rows_to_activate 1 --vertical_merge_algorithm_min_columns_to_activate 1 --allow_vertical_merges_from_compact_to_wide_parts 0 --min_merge_bytes_to_use_direct_io 10711782863 --index_granularity_bytes 22981193 --merge_max_block_size 4385 --index_granularity 6032 --min_bytes_for_wide_part 192245631 --marks_compress_block_size 70992 --primary_key_compress_block_size 18746 --replace_long_file_name_to_hash 1 --max_file_name_length 103 --min_bytes_for_full_part_storage 536870912 --compact_parts_max_bytes_to_buffer 295749633 --compact_parts_max_granules_to_buffer 256 --compact_parts_merge_max_bytes_to_prefetch_part 22900243 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 4 --old_parts_lifetime 422 2025-10-09 12:01:38 2025-10-09 12:01:38 Database: test_8t81rovy 2025-10-09 12:01:38 01935_parametrized_query_parametric_aggregate_function: [ OK ] 1.58 sec. 2025-10-09 12:01:38 02180_group_by_lowcardinality: [ OK ] 0.37 sec. 2025-10-09 12:01:38 01825_type_json_nbagames: [ OK ] 12.15 sec. 2025-10-09 12:01:39 02380_analyzer_join_sample: [ OK ] 0.62 sec. 2025-10-09 12:01:39 02962_analyzer_constant_set: [ OK ] 0.63 sec. 2025-10-09 12:01:39 02787_transform_null: [ OK ] 0.67 sec. 2025-10-09 12:01:39 02049_clickhouse_local_merge_tree: [ OK ] 2.23 sec. 2025-10-09 12:01:39 02183_combinator_if: [ OK ] 1.48 sec. 2025-10-09 12:01:40 02128_apply_lambda_parsing: [ OK ] 0.57 sec. 2025-10-09 12:01:40 00999_settings_no_extra_quotes: [ OK ] 0.57 sec. 2025-10-09 12:01:40 02920_alter_column_of_projections: [ OK ] 0.93 sec. 2025-10-09 12:01:40 02210_processors_profile_log: [ OK ] 2.74 sec. 2025-10-09 12:01:40 01851_s2_to_geo: [ OK ] 0.57 sec. 2025-10-09 12:01:40 01421_assert_in_in: [ OK ] 0.58 sec. 2025-10-09 12:01:40 02236_json_each_row_empty_map_schema_inference: [ OK ] 0.58 sec. 2025-10-09 12:01:41 02267_join_dup_columns_issue36199: [ OK ] 0.98 sec. 2025-10-09 12:01:41 02265_column_ttl: [ OK ] 1.58 sec. 2025-10-09 12:01:41 00700_decimal_defaults: [ OK ] 0.62 sec. 2025-10-09 12:01:41 02810_row_binary_with_defaults: [ OK ] 0.62 sec. 2025-10-09 12:01:41 03066_analyzer_global_with_statement: [ OK ] 0.52 sec. 2025-10-09 12:01:41 01451_replicated_detach_drop_and_quorum_long: [ OK ] 1.02 sec. 2025-10-09 12:01:41 01352_generate_random_overflow: [ OK ] 0.53 sec. 2025-10-09 12:01:41 02875_json_array_as_string: [ OK ] 0.53 sec. 2025-10-09 12:01:42 02457_tuple_of_intervals: [ OK ] 1.18 sec. 2025-10-09 12:01:42 01621_sort_after_join_pipeline_stuck: [ OK ] 0.62 sec. 2025-10-09 12:01:42 01547_query_log_current_database: [ OK ] 1.23 sec. 2025-10-09 12:01:42 02918_multif_for_nullable: [ OK ] 3.93 sec. 2025-10-09 12:01:43 01902_table_function_merge_db_params: [ OK ] 0.73 sec. 2025-10-09 12:01:43 02973_block_number_sparse_serialization_and_mutation: [ OK ] 1.08 sec. 2025-10-09 12:01:43 01661_test_toDayOfWeek_mysql_compatibility: [ OK ] 0.57 sec. 2025-10-09 12:01:43 02021_prewhere_column_optimization: [ OK ] 0.62 sec. 2025-10-09 12:01:43 02884_duplicate_index_name: [ OK ] 0.52 sec. 2025-10-09 12:01:44 02387_parse_date_as_datetime: [ OK ] 0.62 sec. 2025-10-09 12:01:44 00637_sessions_in_http_interface_and_settings: [ OK ] 1.53 sec. 2025-10-09 12:01:44 01326_hostname_alias: [ OK ] 0.52 sec. 2025-10-09 12:01:44 03149_variant_pop_back_typo: [ OK ] 0.52 sec. 2025-10-09 12:01:44 00472_create_view_if_not_exists: [ OK ] 0.47 sec. 2025-10-09 12:01:44 01017_uniqCombined_memory_usage: [ SKIPPED ] 0.00 sec. 2025-10-09 12:01:44 Reason: not running for current build 2025-10-09 12:01:45 02706_kolmogorov_smirnov_test: [ OK ] 0.93 sec. 2025-10-09 12:01:45 01650_fetch_patition_with_macro_in_zk_path_long: [ OK ] 0.78 sec. 2025-10-09 12:01:45 02346_position_countsubstrings_zero_byte: [ OK ] 0.78 sec. 2025-10-09 12:01:45 01527_materialized_view_stack_overflow: [ OK ] 1.93 sec. 2025-10-09 12:01:45 02286_convert_decimal_type: [ OK ] 0.52 sec. 2025-10-09 12:01:45 03147_asof_join_ddb_missing: [ OK ] 4.68 sec. 2025-10-09 12:01:46 02714_date_date32_in: [ OK ] 0.62 sec. 2025-10-09 12:01:46 01269_create_with_null: [ OK ] 0.72 sec. 2025-10-09 12:01:47 00902_entropy: [ OK ] 0.82 sec. 2025-10-09 12:01:47 03161_ipv4_ipv6_equality: [ OK ] 0.63 sec. 2025-10-09 12:01:48 02502_analyzer_insert_select_crash_fix: [ OK ] 1.02 sec. 2025-10-09 12:01:48 02915_analyzer_fuzz_5: [ OK ] 1.02 sec. 2025-10-09 12:01:48 02833_url_without_path_encoding: [ OK ] 3.03 sec. 2025-10-09 12:01:49 01825_type_json_18: [ OK ] 1.07 sec. 2025-10-09 12:01:50 01379_with_fill_several_columns: [ OK ] 1.11 sec. 2025-10-09 12:01:53 02841_not_ready_set_constraints: [ OK ] 2.08 sec. 2025-10-09 12:01:53 00937_test_use_header_csv: [ OK ] 11.97 sec. 2025-10-09 12:01:55 01538_fuzz_aggregate: [ OK ] 2.12 sec. 2025-10-09 12:01:58 02325_compatibility_setting_2: [ OK ] 2.74 sec. 2025-10-09 12:01:58 03207_json_read_subcolumns_2_memory: [ SKIPPED ] 0.00 sec. 2025-10-09 12:01:58 Reason: not running for current build 2025-10-09 12:01:58 02933_replicated_database_forbid_create_as_select: [ OK ] 12.17 sec. 2025-10-09 12:01:59 02513_broken_datetime64_init_on_mac: [ OK ] 0.79 sec. 2025-10-09 12:02:00 01139_asof_join_types: [ OK ] 2.48 sec. 2025-10-09 12:02:02 02021_exponential_sum_shard: [ OK ] 14.29 sec. 2025-10-09 12:02:03 00050_any_left_join: [ OK ] 0.95 sec. 2025-10-09 12:02:03 02428_delete_with_settings: [ OK ] 4.67 sec. 2025-10-09 12:02:05 02165_h3_edge_length_km: [ OK ] 1.20 sec. 2025-10-09 12:02:05 02461_alter_update_respect_part_column_type_bug: [ OK ] 4.42 sec. 2025-10-09 12:02:06 00157_aliases_and_lambda_formal_parameters: [ OK ] 0.85 sec. 2025-10-09 12:02:06 03143_parallel_replicas_mat_view_bug: [ OK ] 0.85 sec. 2025-10-09 12:02:06 01328_bad_peephole_optimization: [ OK ] 0.68 sec. 2025-10-09 12:02:07 00712_prewhere_with_alias_bug_2: [ OK ] 1.00 sec. 2025-10-09 12:02:08 01866_datetime64_cmp_with_constant: [ OK ] 1.91 sec. 2025-10-09 12:02:08 02154_bit_slice_for_fixedstring: [ OK ] 4.62 sec. 2025-10-09 12:02:10 00578_merge_table_and_table_virtual_column: [ OK ] 1.74 sec. 2025-10-09 12:02:11 00700_to_decimal_or_something: [ OK ] 2.58 sec. 2025-10-09 12:02:14 02353_compression_level: [ OK ] 26.30 sec. 2025-10-09 12:02:17 02461_cancel_finish_race: [ OK ] 31.53 sec. 2025-10-09 12:02:17 01323_if_with_nulls: [ OK ] 2.63 sec. 2025-10-09 12:02:18 01300_group_by_other_keys_having: [ OK ] 10.05 sec. 2025-10-09 12:02:18 02871_multiple_joins_rewriter_v2_handle_last_table_columns: [ OK ] 0.67 sec. 2025-10-09 12:02:18 01040_distributed_background_insert_batch_inserts: [ OK ] 1.13 sec. 2025-10-09 12:02:19 00626_replace_partition_from_table_zookeeper: [ OK ] 68.86 sec. 2025-10-09 12:02:19 01137_sample_final: [ OK ] 0.67 sec. 2025-10-09 12:02:19 03199_unbin_buffer_overflow: [ OK ] 26.08 sec. 2025-10-09 12:02:19 02867_null_lc_in_bug: [ OK ] 0.67 sec. 2025-10-09 12:02:19 00085_visible_width_of_tuple_of_dates: [ OK ] 0.52 sec. 2025-10-09 12:02:19 01673_test_toMinute_mysql_dialect: [ OK ] 0.57 sec. 2025-10-09 12:02:20 02525_analyzer_function_in_crash_fix: [ OK ] 0.67 sec. 2025-10-09 12:02:20 03033_set_index_in: [ OK ] 1.02 sec. 2025-10-09 12:02:20 02184_ipv6_select_parsing: [ OK ] 0.78 sec. 2025-10-09 12:02:21 00467_qualified_names: [ OK ] 0.98 sec. 2025-10-09 12:02:21 02572_max_intersections: [ OK ] 0.52 sec. 2025-10-09 12:02:22 01796_Log_rwlock_ub: [ OK ] 0.57 sec. 2025-10-09 12:02:22 01245_limit_infinite_sources: [ OK ] 2.63 sec. 2025-10-09 12:02:22 01273_arrow_load: [ OK ] 4.13 sec. 2025-10-09 12:02:22 01353_low_cardinality_join_types: [ OK ] 1.28 sec. 2025-10-09 12:02:22 02923_cte_equality_disjunction: [ OK ] 0.52 sec. 2025-10-09 12:02:22 02355_control_block_size_in_array_join: [ OK ] 0.73 sec. 2025-10-09 12:02:22 01818_case_float_value_fangyc: [ OK ] 0.57 sec. 2025-10-09 12:02:22 00732_quorum_insert_lost_part_zookeeper_long: [ OK ] 0.93 sec. 2025-10-09 12:02:23 02012_sha512_fixedstring: [ OK ] 0.62 sec. 2025-10-09 12:02:23 00952_basic_constraints: [ OK ] 12.44 sec. 2025-10-09 12:02:23 02326_numbers_from_json_strings_schema_inference: [ OK ] 0.82 sec. 2025-10-09 12:02:23 00725_join_on_bug_2: [ OK ] 0.92 sec. 2025-10-09 12:02:24 03013_position_const_start_pos: [ OK ] 0.58 sec. 2025-10-09 12:02:24 02876_yyyymmddtodate: [ OK ] 1.83 sec. 2025-10-09 12:02:24 02540_analyzer_matcher_alias_materialized_columns: [ OK ] 0.72 sec. 2025-10-09 12:02:24 00514_interval_operators: [ OK ] 0.88 sec. 2025-10-09 12:02:24 02122_parallel_formatting_JSONEachRow: [ OK ] 4.84 sec. 2025-10-09 12:02:24 00298_enum_width_and_cast: [ OK ] 0.67 sec. 2025-10-09 12:02:25 02811_insert_schema_inference: [ OK ] 0.58 sec. 2025-10-09 12:02:25 01011_test_create_as_skip_indices: [ OK ] 0.57 sec. 2025-10-09 12:02:25 02815_range_dict_no_direct_join: [ OK ] 0.62 sec. 2025-10-09 12:02:25 02113_untuple_func_alias: [ OK ] 0.52 sec. 2025-10-09 12:02:25 01291_distributed_low_cardinality_memory_efficient: [ OK ] 0.62 sec. 2025-10-09 12:02:25 00468_array_join_multiple_arrays_and_use_original_column: [ OK ] 0.67 sec. 2025-10-09 12:02:26 02306_rowbinary_has_no_bom: [ OK ] 1.58 sec. 2025-10-09 12:02:26 02343_group_by_use_nulls: [ OK ] 0.78 sec. 2025-10-09 12:02:27 03079_analyzer_numeric_literals_as_column_names: [ OK ] 0.62 sec. 2025-10-09 12:02:27 00823_sequence_match_dfa: [ OK ] 1.28 sec. 2025-10-09 12:02:27 01072_json_each_row_data_in_square_brackets: [ OK ] 0.57 sec. 2025-10-09 12:02:28 02160_client_autocomplete_parse_query: [ OK ] 3.08 sec. 2025-10-09 12:02:28 02981_translate_fixedstring: [ OK ] 0.57 sec. 2025-10-09 12:02:28 01389_filter_by_virtual_columns: [ OK ] 0.57 sec. 2025-10-09 12:02:28 01375_null_issue_3767: [ OK ] 0.57 sec. 2025-10-09 12:02:29 00054_join_string: [ OK ] 0.57 sec. 2025-10-09 12:02:29 03142_window_function_limit_by: [ OK ] 0.68 sec. 2025-10-09 12:02:29 02971_functions_to_subcolumns_map: [ OK ] 0.62 sec. 2025-10-09 12:02:30 02122_parallel_formatting_RowBinaryWithNames: [ OK ] 4.08 sec. 2025-10-09 12:02:30 02814_create_index_uniq_noop: [ OK ] 0.53 sec. 2025-10-09 12:02:30 00101_materialized_views_and_insert_without_explicit_database: [ OK ] 1.03 sec. 2025-10-09 12:02:30 02428_combinators_with_over_statement: [ OK ] 0.63 sec. 2025-10-09 12:02:30 01060_window_view_event_tumble_to_asc: [ OK ] 5.04 sec. 2025-10-09 12:02:31 02990_format_not_precedence: [ OK ] 0.67 sec. 2025-10-09 12:02:31 00152_totals_in_subquery: [ OK ] 0.58 sec. 2025-10-09 12:02:32 03199_fix_auc_tie_handling: [ OK ] 0.68 sec. 2025-10-09 12:02:32 02771_tsv_csv_custom_skip_trailing_empty_lines: [ OK ] 0.73 sec. 2025-10-09 12:02:32 02906_flatten_only_true_nested: [ OK ] 0.57 sec. 2025-10-09 12:02:33 01903_http_fields: [ OK ] 2.73 sec. 2025-10-09 12:02:33 02999_scalar_subqueries_bug_2: [ OK ] 0.57 sec. 2025-10-09 12:02:33 03173_distinct_combinator_alignment: [ OK ] 0.57 sec. 2025-10-09 12:02:33 01660_join_or_all: [ OK ] 1.63 sec. 2025-10-09 12:02:34 02456_alter-nullable-column-bag: [ OK ] 0.68 sec. 2025-10-09 12:02:34 01825_type_json_7: [ OK ] 4.29 sec. 2025-10-09 12:02:35 01359_geodistance_loop: [ OK ] 0.57 sec. 2025-10-09 12:02:35 00612_http_max_query_size_for_distributed: [ OK ] 0.62 sec. 2025-10-09 12:02:37 02517_avro_bool_type: [ OK ] 1.98 sec. 2025-10-09 12:02:38 02002_row_level_filter_bug: [ OK ] 10.15 sec. 2025-10-09 12:02:38 01811_storage_buffer_flush_parameters: [ OK ] 4.89 sec. 2025-10-09 12:02:38 02686_bson3: [ OK ] 0.57 sec. 2025-10-09 12:02:39 03161_lightweight_delete_projection: [ OK ] 0.87 sec. 2025-10-09 12:02:39 00065_shard_float_literals_formatting: [ OK ] 0.57 sec. 2025-10-09 12:02:40 02421_new_type_json_async_insert: [ OK ] 5.44 sec. 2025-10-09 12:02:40 00038_totals_limit: [ OK ] 0.63 sec. 2025-10-09 12:02:40 03073_analyzer_alias_as_column_name: [ OK ] 0.62 sec. 2025-10-09 12:02:41 03230_anyHeavy_merge: [ OK ] 0.62 sec. 2025-10-09 12:02:42 02476_fuse_sum_count: [ OK ] 0.92 sec. 2025-10-09 12:02:43 01035_avg: [ OK ] 5.23 sec. 2025-10-09 12:02:43 00318_pk_tuple_order: [ OK ] 1.48 sec. 2025-10-09 12:02:44 03208_uniq_with_empty_tuple: [ OK ] 0.62 sec. 2025-10-09 12:02:44 01528_setting_aggregate_functions_null_for_empty: [ OK ] 0.93 sec. 2025-10-09 12:02:44 02000_table_function_cluster_macros: [ OK ] 0.62 sec. 2025-10-09 12:02:45 02122_parallel_formatting_TSV: [ OK ] 4.48 sec. 2025-10-09 12:02:45 03008_uniq_exact_equal_ranges: [ OK ] 6.84 sec. 2025-10-09 12:02:46 02725_alias_columns_should_not_allow_compression_codec: [ OK ] 0.62 sec. 2025-10-09 12:02:46 02267_special_operator_parse_alias_check: [ OK ] 1.13 sec. 2025-10-09 12:02:46 02989_variant_comparison: [ OK ] 1.13 sec. 2025-10-09 12:02:46 02902_select_subcolumns_from_engine_null: [ OK ] 0.57 sec. 2025-10-09 12:02:46 02988_join_using_prewhere_pushdown: [ OK ] 0.62 sec. 2025-10-09 12:02:48 03036_parquet_arrow_nullable: [ OK ] 14.51 sec. 2025-10-09 12:02:49 03006_async_insert_deadlock_log: [ OK ] 4.63 sec. 2025-10-09 12:02:50 00833_sleep_overflow: [ OK ] 0.62 sec. 2025-10-09 12:02:50 01058_window_view_event_hop_to_strict_asc: [ OK ] 4.73 sec. 2025-10-09 12:02:50 03203_optimize_disjunctions_chain_to_in: [ OK ] 0.62 sec. 2025-10-09 12:02:51 02368_analyzer_table_functions: [ OK ] 0.62 sec. 2025-10-09 12:02:52 01387_clear_column_default_depends: [ OK ] 0.93 sec. 2025-10-09 12:02:52 00974_primary_key_for_lowCardinality: [ OK ] 5.64 sec. 2025-10-09 12:02:53 00271_agg_state_and_totals: [ OK ] 0.63 sec. 2025-10-09 12:02:53 02312_parquet_orc_arrow_names_tuples: [ OK ] 0.88 sec. 2025-10-09 12:02:53 00411_long_accurate_number_comparison_int2: [ OK ] 29.75 sec. 2025-10-09 12:02:53 02711_trim_aliases: [ OK ] 0.57 sec. 2025-10-09 12:02:54 02516_projections_with_rollup: [ OK ] 6.04 sec. 2025-10-09 12:02:54 01942_snowflakeIDToDateTime: [ OK ] 1.07 sec. 2025-10-09 12:02:54 00931_low_cardinality_nullable_aggregate_function_type: [ OK ] 0.73 sec. 2025-10-09 12:02:55 00702_join_on_dups: [ OK ] 1.43 sec. 2025-10-09 12:02:55 01119_optimize_trivial_insert_select: [ OK ] 1.73 sec. 2025-10-09 12:02:56 00758_array_reverse: [ OK ] 0.70 sec. 2025-10-09 12:02:56 00974_full_outer_join: [ OK ] 0.52 sec. 2025-10-09 12:02:56 02705_settings_check_changed_flag: [ OK ] 1.43 sec. 2025-10-09 12:02:56 01767_timezoneOf: [ OK ] 1.73 sec. 2025-10-09 12:02:57 03276_functions_to_subcolumns_lc: [ OK ] 0.58 sec. 2025-10-09 12:02:57 02982_parallel_replicas_unexpected_cluster: [ OK ] 0.62 sec. 2025-10-09 12:02:57 02941_variant_type_4: [ OK ] 46.76 sec. 2025-10-09 12:02:57 02562_with_fill_nullable: [ OK ] 0.58 sec. 2025-10-09 12:02:58 01281_parseDateTime64BestEffort: [ OK ] 1.18 sec. 2025-10-09 12:02:58 01355_CSV_input_format_allow_errors: [ OK ] 4.08 sec. 2025-10-09 12:02:58 02457_filesystem_function: [ OK ] 0.57 sec. 2025-10-09 12:02:59 03077_analyzer_multi_scalar_subquery_aliases: [ OK ] 0.57 sec. 2025-10-09 12:02:59 01532_clickhouse_local_tmp_folder: [ OK ] 1.73 sec. 2025-10-09 12:02:59 02734_optimize_group_by: [ OK ] 0.62 sec. 2025-10-09 12:02:59 00623_replicated_truncate_table_zookeeper_long: [ OK ] 0.87 sec. 2025-10-09 12:02:59 01395_limit_more_cases: [ OK ] 78.07 sec. 2025-10-09 12:03:00 01926_bin_unbin: [ OK ] 0.98 sec. 2025-10-09 12:03:00 00447_foreach_modifier: [ OK ] 0.82 sec. 2025-10-09 12:03:00 03005_input_function_in_join: [ OK ] 0.59 sec. 2025-10-09 12:03:00 02588_avro_date32_and_decimals: [ OK ] 3.33 sec. 2025-10-09 12:03:00 02699_polygons_sym_difference_rollup: [ OK ] 0.62 sec. 2025-10-09 12:03:00 02514_tsv_zero_started_number: [ OK ] 0.47 sec. 2025-10-09 12:03:01 02730_with_fill_by_sorting_prefix: [ OK ] 1.03 sec. 2025-10-09 12:03:01 02868_operator_is_not_distinct_from_priority: [ OK ] 0.57 sec. 2025-10-09 12:03:01 02335_column_ttl_expired_column_optimization: [ OK ] 2.13 sec. 2025-10-09 12:03:01 01662_date_ubsan: [ OK ] 1.38 sec. 2025-10-09 12:03:01 02916_replication_protocol_wait_for_part: [ OK ] 10.95 sec. 2025-10-09 12:03:01 01825_new_type_json_insert_select: [ OK ] 1.78 sec. 2025-10-09 12:03:01 02017_columns_with_dot_2: [ OK ] 0.58 sec. 2025-10-09 12:03:01 03160_dynamic_type_agg: [ OK ] 0.58 sec. 2025-10-09 12:03:01 01926_union_all_schmak: [ OK ] 0.57 sec. 2025-10-09 12:03:02 03093_with_fill_support_constant_expression: [ OK ] 0.57 sec. 2025-10-09 12:03:02 01603_remove_column_ttl: [ OK ] 0.62 sec. 2025-10-09 12:03:02 02723_jit_aggregation_bug_48120: [ OK ] 0.87 sec. 2025-10-09 12:03:03 01071_in_array: [ OK ] 0.62 sec. 2025-10-09 12:03:03 02429_low_cardinality_trash: [ OK ] 1.54 sec. 2025-10-09 12:03:03 02520_group_array_last: [ OK ] 1.28 sec. 2025-10-09 12:03:04 03269_partition_key_not_in_set: [ OK ] 1.38 sec. 2025-10-09 12:03:04 01790_dist_INSERT_block_structure_mismatch_types_and_names: [ OK ] 0.68 sec. 2025-10-09 12:03:04 02896_leading_zeroes_no_octal: [ OK ] 3.08 sec. 2025-10-09 12:03:05 02461_mullable_pk_monotonicity_bug: [ OK ] 1.48 sec. 2025-10-09 12:03:05 02995_index_9: [ SKIPPED ] 0.00 sec. 2025-10-09 12:03:05 Reason: not running for current build 2025-10-09 12:03:06 00322_disable_checksumming: [ OK ] 1.58 sec. 2025-10-09 12:03:06 00197_if_fixed_string: [ OK ] 0.78 sec. 2025-10-09 12:03:07 01246_extractAllGroupsVertical: [ OK ] 1.08 sec. 2025-10-09 12:03:07 02496_remove_redundant_sorting: [ OK ] 21.13 sec. 2025-10-09 12:03:08 01825_new_type_json_12: [ OK ] 6.84 sec. 2025-10-09 12:03:09 03007_column_nullable_uninitialzed_value: [ OK ] 0.48 sec. 2025-10-09 12:03:09 01143_trivial_count_with_join: [ OK ] 0.63 sec. 2025-10-09 12:03:10 02015_async_inserts_1: [ OK ] 3.48 sec. 2025-10-09 12:03:10 01646_fix_window_funnel_inconistency: [ OK ] 0.73 sec. 2025-10-09 12:03:10 00652_replicated_mutations_default_database_zookeeper: [ OK ] 3.79 sec. 2025-10-09 12:03:11 02045_like_function: [ OK ] 0.53 sec. 2025-10-09 12:03:11 03208_array_of_json_read_subcolumns_1: [ OK ] 9.25 sec. 2025-10-09 12:03:11 00732_quorum_insert_simple_test_2_parts_zookeeper_long: [ OK ] 1.13 sec. 2025-10-09 12:03:12 01651_lc_insert_tiny_log_3: [ OK ] 7.09 sec. 2025-10-09 12:03:12 00453_cast_enum: [ OK ] 0.69 sec. 2025-10-09 12:03:12 01416_join_totals_header_bug: [ OK ] 0.62 sec. 2025-10-09 12:03:12 01353_neighbor_overflow: [ OK ] 0.57 sec. 2025-10-09 12:03:12 00974_low_cardinality_cast: [ OK ] 0.67 sec. 2025-10-09 12:03:13 00030_alter_table: [ OK ] 1.13 sec. 2025-10-09 12:03:14 00679_uuid_in_key: [ OK ] 0.68 sec. 2025-10-09 12:03:15 01680_predicate_pushdown_union_distinct_subquery: [ OK ] 0.58 sec. 2025-10-09 12:03:15 01710_normal_projections: [ OK ] 11.85 sec. 2025-10-09 12:03:15 02510_group_by_prewhere_null: [ OK ] 0.57 sec. 2025-10-09 12:03:15 00825_protobuf_format_nested_in_nested: [ OK ] 4.12 sec. 2025-10-09 12:03:16 01710_normal_projection_with_query_plan_optimization: [ OK ] 0.72 sec. 2025-10-09 12:03:16 02563_async_insert_bad_data: [ OK ] 3.38 sec. 2025-10-09 12:03:16 01851_array_difference_decimal_overflow_ubsan: [ OK ] 0.62 sec. 2025-10-09 12:03:16 01069_insert_float_as_nullable_unit8: [ OK ] 0.52 sec. 2025-10-09 12:03:16 01710_projections_and_duplicate_columms: [ OK ] 0.72 sec. 2025-10-09 12:03:16 00127_group_by_concat: [ OK ] 0.57 sec. 2025-10-09 12:03:16 01473_system_events_zeroes: [ OK ] 0.53 sec. 2025-10-09 12:03:17 01710_projection_detach_part: [ OK ] 0.57 sec. 2025-10-09 12:03:17 01070_alter_with_ttl: [ OK ] 0.57 sec. 2025-10-09 12:03:17 03159_dynamic_type_all_types: [ OK ] 1.02 sec. 2025-10-09 12:03:17 00752_low_cardinality_array_result: [ OK ] 0.53 sec. 2025-10-09 12:03:17 01514_input_format_json_enum_as_number: [ OK ] 0.57 sec. 2025-10-09 12:03:18 02935_format_with_arbitrary_types: [ OK ] 1.43 sec. 2025-10-09 12:03:18 01732_union_and_union_all: [ OK ] 0.53 sec. 2025-10-09 12:03:18 02221_system_zookeeper_unrestricted_like: [ OK ] 5.99 sec. 2025-10-09 12:03:18 02995_index_6: [ SKIPPED ] 0.00 sec. 2025-10-09 12:03:18 Reason: not running for current build 2025-10-09 12:03:18 00621_regression_for_in_operator: [ OK ] 0.83 sec. 2025-10-09 12:03:18 00063_check_query: [ OK ] 0.73 sec. 2025-10-09 12:03:19 01848_partition_value_column: [ OK ] 0.82 sec. 2025-10-09 12:03:19 02815_first_line: [ OK ] 0.62 sec. 2025-10-09 12:03:19 00947_ml_test: [ OK ] 0.82 sec. 2025-10-09 12:03:19 01259_datetime64_ubsan: [ OK ] 0.62 sec. 2025-10-09 12:03:19 01684_insert_specify_shard_id: [ OK ] 0.98 sec. 2025-10-09 12:03:19 02366_explain_query_tree: [ OK ] 0.68 sec. 2025-10-09 12:03:20 00927_disable_hyperscan: [ OK ] 0.87 sec. 2025-10-09 12:03:20 00564_versioned_collapsing_merge_tree: [ OK ] 9.60 sec. 2025-10-09 12:03:20 00506_shard_global_in_union: [ OK ] 1.03 sec. 2025-10-09 12:03:20 01940_custom_tld_sharding_key: [ OK ] 0.57 sec. 2025-10-09 12:03:21 00404_null_literal: [ OK ] 0.57 sec. 2025-10-09 12:03:21 02112_delayed_clickhouse_client_with_queries_file: [ OK ] 2.03 sec. 2025-10-09 12:03:21 02875_parallel_replicas_remote: [ OK ] 1.53 sec. 2025-10-09 12:03:21 03033_lightweight_deletes_sync: [ OK ] 0.67 sec. 2025-10-09 12:03:21 00360_to_date_from_string_with_datetime: [ OK ] 0.52 sec. 2025-10-09 12:03:22 00071_insert_fewer_columns: [ OK ] 0.57 sec. 2025-10-09 12:03:22 02521_analyzer_array_join_crash: [ OK ] 0.73 sec. 2025-10-09 12:03:22 01798_uniq_theta_sketch: [ OK ] 2.28 sec. 2025-10-09 12:03:22 00499_json_enum_insert: [ OK ] 0.57 sec. 2025-10-09 12:03:22 03207_json_read_subcolumns_2_wide_merge_tree: [ SKIPPED ] 0.00 sec. 2025-10-09 12:03:22 Reason: not running for current build 2025-10-09 12:03:23 03034_recursive_cte_tree: [ OK ] 0.73 sec. 2025-10-09 12:03:23 02674_date_int_string_json_inference: [ OK ] 0.52 sec. 2025-10-09 12:03:23 02426_pod_array_overflow_3: [ OK ] 0.47 sec. 2025-10-09 12:03:24 02949_ttl_group_by_bug: [ OK ] 0.67 sec. 2025-10-09 12:03:24 02711_server_uuid_macro: [ OK ] 0.82 sec. 2025-10-09 12:03:24 00090_union_race_conditions_1: [ OK ] 24.39 sec. 2025-10-09 12:03:24 01083_match_zero_byte: [ OK ] 0.62 sec. 2025-10-09 12:03:24 01430_modify_sample_by_zookeeper_long: [ OK ] 1.78 sec. 2025-10-09 12:03:25 01091_insert_with_default_json: [ OK ] 0.63 sec. 2025-10-09 12:03:25 01825_type_json_4: [ OK ] 5.69 sec. 2025-10-09 12:03:26 00908_long_http_insert: [ OK ] 2.08 sec. 2025-10-09 12:03:26 03006_buffer_overflow_join: [ OK ] 0.57 sec. 2025-10-09 12:03:26 02385_analyzer_aliases_compound_expression: [ OK ] 0.67 sec. 2025-10-09 12:03:27 02020_exponential_smoothing: [ OK ] 2.28 sec. 2025-10-09 12:03:27 01136_multiple_sets: [ OK ] 0.79 sec. 2025-10-09 12:03:28 00354_host_command_line_option: [ OK ] 3.04 sec. 2025-10-09 12:03:28 02562_native_tskv_default_for_omitted_fields: [ OK ] 8.69 sec. 2025-10-09 12:03:28 03116_analyzer_explicit_alias_as_column_name: [ OK ] 0.52 sec. 2025-10-09 12:03:28 02030_client_unknown_database: [ OK ] 2.00 sec. 2025-10-09 12:03:28 00880_decimal_in_key: [ OK ] 1.48 sec. 2025-10-09 12:03:28 02155_nested_lc_defalut_bug: [ OK ] 0.62 sec. 2025-10-09 12:03:29 01550_query_identifier_parameters: [ OK ] 4.03 sec. 2025-10-09 12:03:29 02882_formatQuery: [ OK ] 0.97 sec. 2025-10-09 12:03:29 03144_asof_join_ddb_doubles: [ OK ] 0.77 sec. 2025-10-09 12:03:29 02969_functions_to_subcolumns_if_null: [ OK ] 0.62 sec. 2025-10-09 12:03:29 03043_group_array_result_is_expected: [ OK ] 0.67 sec. 2025-10-09 12:03:30 02157_readonly_system_suspend: [ OK ] 1.98 sec. 2025-10-09 12:03:30 00337_shard_any_heavy: [ OK ] 0.57 sec. 2025-10-09 12:03:30 01521_max_length_alias: [ OK ] 0.67 sec. 2025-10-09 12:03:30 02782_avro_decimals: [ OK ] 2.08 sec. 2025-10-09 12:03:31 01720_country_perimeter_and_area: [ OK ] 9.30 sec. 2025-10-09 12:03:31 02008_test_union_distinct_in_subquery: [ OK ] 0.77 sec. 2025-10-09 12:03:31 01047_simple_aggregate_sizes_of_columns_bug: [ OK ] 1.58 sec. 2025-10-09 12:03:31 01041_h3_is_valid: [ OK ] 0.52 sec. 2025-10-09 12:03:32 01276_alter_rename_column_materialized_expr: [ OK ] 0.97 sec. 2025-10-09 12:03:32 03156_nullable_number_tips: [ OK ] 0.73 sec. 2025-10-09 12:03:33 02872_prewhere_filter: [ OK ] 0.62 sec. 2025-10-09 12:03:33 00900_null_array_orc_load: [ OK ] 3.83 sec. 2025-10-09 12:03:33 00925_zookeeper_empty_replicated_merge_tree_optimize_final_long: [ OK ] 5.18 sec. 2025-10-09 12:03:34 00100_subquery_table_identifier: [ OK ] 3.88 sec. 2025-10-09 12:03:34 03121_analyzer_filed_redefenition_in_subquery: [ OK ] 0.57 sec. 2025-10-09 12:03:34 03032_numbers_zeros: [ OK ] 0.77 sec. 2025-10-09 12:03:35 03209_parameterized_view_with_non_literal_params: [ OK ] 1.63 sec. 2025-10-09 12:03:35 03210_dynamic_squashing: [ OK ] 1.58 sec. 2025-10-09 12:03:35 01915_merge_prewhere_virtual_column_rand_chao_wang: [ OK ] 0.68 sec. 2025-10-09 12:03:36 02922_server_exit_code: [ OK ] 1.88 sec. 2025-10-09 12:03:36 02703_max_local_read_bandwidth: [ OK ] 29.10 sec. 2025-10-09 12:03:36 01553_datetime64_comparison: [ OK ] 0.52 sec. 2025-10-09 12:03:37 02581_width_bucket: [ OK ] 1.43 sec. 2025-10-09 12:03:37 01273_lc_fixed_string_field: [ OK ] 0.63 sec. 2025-10-09 12:03:37 00616_final_single_part: [ OK ] 0.77 sec. 2025-10-09 12:03:37 01017_mutations_with_nondeterministic_functions_zookeeper: [ OK ] 7.19 sec. 2025-10-09 12:03:38 02003_compress_bz2: [ OK ] 2.48 sec. 2025-10-09 12:03:38 02956_fix_to_start_of_milli_microsecond: [ OK ] 0.62 sec. 2025-10-09 12:03:38 01104_fixed_string_like: [ OK ] 1.12 sec. 2025-10-09 12:03:38 00752_low_cardinality_lambda_argument: [ OK ] 0.67 sec. 2025-10-09 12:03:38 03010_read_system_parts_table_test: [ OK ] 0.68 sec. 2025-10-09 12:03:38 02999_analyzer_preimage_null: [ OK ] 0.63 sec. 2025-10-09 12:03:39 03143_group_by_constant_secondary: [ OK ] 0.58 sec. 2025-10-09 12:03:39 01098_sum: [ OK ] 0.73 sec. 2025-10-09 12:03:39 02560_quantile_min_max: [ OK ] 0.63 sec. 2025-10-09 12:03:39 01346_alter_enum_partition_key_replicated_zookeeper_long: [ OK ] 1.68 sec. 2025-10-09 12:03:40 00604_show_create_database: [ OK ] 0.42 sec. 2025-10-09 12:03:40 00617_array_in: [ OK ] 0.68 sec. 2025-10-09 12:03:40 01582_distinct_subquery_groupby: [ OK ] 0.73 sec. 2025-10-09 12:03:41 02021_map_bloom_filter_index: [ OK ] 1.58 sec. 2025-10-09 12:03:42 00276_sample: [ OK ] 3.69 sec. 2025-10-09 12:03:42 03039_recursive_cte_postgres_5: [ OK ] 1.23 sec. 2025-10-09 12:03:42 03069_analyzer_with_alias_in_array_join: [ OK ] 0.53 sec. 2025-10-09 12:03:42 03040_dynamic_type_alters_1_memory: [ OK ] 1.18 sec. 2025-10-09 12:03:43 03042_not_found_column_c1: [ OK ] 0.62 sec. 2025-10-09 12:03:43 03004_force_null_for_omitted: [ OK ] 1.13 sec. 2025-10-09 12:03:43 02835_join_step_explain: [ OK ] 0.67 sec. 2025-10-09 12:03:44 00976_max_execution_speed: [ OK ] 3.53 sec. 2025-10-09 12:03:44 02972_to_string_nullable_timezone: [ OK ] 0.63 sec. 2025-10-09 12:03:44 01065_if_not_finite: [ OK ] 0.68 sec. 2025-10-09 12:03:45 02806_cte_block_cannot_be_empty: [ OK ] 0.58 sec. 2025-10-09 12:03:45 01102_distributed_local_in_bug: [ OK ] 0.73 sec. 2025-10-09 12:03:46 02267_insert_empty_data: [ OK ] 0.57 sec. 2025-10-09 12:03:47 01710_projection_row_policy: [ OK ] 0.78 sec. 2025-10-09 12:03:47 02793_implicit_pretty_format_settings: [ OK ] 2.08 sec. 2025-10-09 12:03:48 02962_parallel_window_functions_different_partitioning: [ OK ] 0.93 sec. 2025-10-09 12:03:48 00355_array_of_non_const_convertible_types: [ OK ] 1.08 sec. 2025-10-09 12:03:49 01585_use_index_for_global_in: [ OK ] 1.15 sec. 2025-10-09 12:03:50 01155_old_mutation_parts_to_do: [ OK ] 17.93 sec. 2025-10-09 12:03:50 01356_initialize_aggregation: [ OK ] 0.99 sec. 2025-10-09 12:03:50 01446_json_strings_each_row: [ OK ] 16.62 sec. 2025-10-09 12:03:51 02353_ascii: [ OK ] 0.52 sec. 2025-10-09 12:03:51 01069_materialized_view_alter_target_table: [ OK ] 0.67 sec. 2025-10-09 12:03:51 02344_describe_cache: [ OK ] 2.94 sec. 2025-10-09 12:03:51 02731_nothing_deserialization: [ OK ] 0.57 sec. 2025-10-09 12:03:52 02340_analyzer_functions: [ OK ] 0.67 sec. 2025-10-09 12:03:52 01104_distributed_one_test: [ OK ] 0.88 sec. 2025-10-09 12:03:53 02564_read_in_order_final_desc: [ OK ] 0.68 sec. 2025-10-09 12:03:53 00618_nullable_in: [ OK ] 0.57 sec. 2025-10-09 12:03:54 00729_prewhere_array_join: [ OK ] 1.08 sec. 2025-10-09 12:03:55 00164_not_chain: [ OK ] 0.57 sec. 2025-10-09 12:03:55 00534_functions_bad_arguments2: [ OK ] 16.94 sec. 2025-10-09 12:03:55 02255_broken_parts_chain_on_start: [ OK ] 12.32 sec. 2025-10-09 12:03:55 00422_hash_function_constexpr: [ OK ] 0.57 sec. 2025-10-09 12:03:55 01509_check_many_parallel_quorum_inserts_long: [ OK ] 13.22 sec. 2025-10-09 12:03:56 02097_remove_sample_by: [ OK ] 0.83 sec. 2025-10-09 12:03:56 01392_column_resolve: [ OK ] 0.68 sec. 2025-10-09 12:03:57 02922_respect_nulls_extensive: [ OK ] 1.48 sec. 2025-10-09 12:03:58 02325_dates_schema_inference: [ OK ] 1.28 sec. 2025-10-09 12:04:00 01778_where_with_column_name: [ OK ] 1.18 sec. 2025-10-09 12:04:00 02561_temporary_table_grants: [ OK ] 10.15 sec. 2025-10-09 12:04:00 00240_replace_substring_loop: [ OK ] 4.26 sec. 2025-10-09 12:04:01 02889_print_pretty_type_names: [ OK ] 0.84 sec. 2025-10-09 12:04:02 00177_inserts_through_http_parts: [ OK ] 2.47 sec. 2025-10-09 12:04:03 01710_projection_in_set: [ OK ] 2.77 sec. 2025-10-09 12:04:03 00495_reading_const_zero_column: [ OK ] 1.63 sec. 2025-10-09 12:04:03 03167_empty_tuple_concat: [ OK ] 0.69 sec. 2025-10-09 12:04:06 00686_client_exit_code: [ OK ] 2.47 sec. 2025-10-09 12:04:07 01914_index_bgranvea: [ OK ] 1.30 sec. 2025-10-09 12:04:08 02122_parallel_formatting_JSONCompactStringsEachRowWithNames: [ OK ] 11.69 sec. 2025-10-09 12:04:08 00834_date_datetime_cmp: [ OK ] 0.74 sec. 2025-10-09 12:04:08 02963_test_flexible_disk_configuration: [ OK ] 5.38 sec. 2025-10-09 12:04:08 02881_system_detached_parts_modification_time: [ OK ] 1.05 sec. 2025-10-09 12:04:09 01702_toDateTime_from_string_clamping: [ OK ] 0.70 sec. 2025-10-09 12:04:11 02009_body_query_params: [ OK ] 2.14 sec. 2025-10-09 12:04:11 03127_argMin_combinator_state: [ OK ] 0.95 sec. 2025-10-09 12:04:11 01284_escape_sequences_php_mysql_style: [ OK ] 0.85 sec. 2025-10-09 12:04:12 02136_kill_scalar_queries: [ OK ] 3.42 sec. 2025-10-09 12:04:12 02995_index_5: [ SKIPPED ] 0.00 sec. 2025-10-09 12:04:12 Reason: not running for current build 2025-10-09 12:04:12 02125_lz4_compression_bug_CSV: [ OK ] 21.17 sec. 2025-10-09 12:04:13 01079_bit_operations_using_bitset: [ OK ] 1.30 sec. 2025-10-09 12:04:14 00260_like_and_curly_braces: [ OK ] 1.70 sec. 2025-10-09 12:04:16 01483_merge_table_join_and_group_by: [ OK ] 2.65 sec. 2025-10-09 12:04:17 01432_parse_date_time_best_effort_timestamp: [ OK ] 0.70 sec. 2025-10-09 12:04:19 01947_mv_subquery: [ OK ] 16.13 sec. 2025-10-09 12:04:19 01080_window_view_inner_table_memory_hop: [ OK ] 8.57 sec. 2025-10-09 12:04:20 01682_gather_utils_ubsan: [ OK ] 0.74 sec. 2025-10-09 12:04:20 01755_shard_pruning_with_literal: [ OK ] 1.20 sec. 2025-10-09 12:04:21 00196_float32_formatting: [ OK ] 0.80 sec. 2025-10-09 12:04:21 02366_kql_summarize: [ OK ] 4.27 sec. 2025-10-09 12:04:22 00933_alter_ttl: [ OK ] 1.87 sec. 2025-10-09 12:04:22 02346_fulltext_index_bug52019: [ OK ] 1.30 sec. 2025-10-09 12:04:23 02959_system_database_engines: [ OK ] 0.76 sec. 2025-10-09 12:04:24 02579_fill_empty_chunk_analyzer: [ OK ] 0.75 sec. 2025-10-09 12:04:25 01068_parens: [ OK ] 0.60 sec. 2025-10-09 12:04:25 01388_clear_all_columns: [ OK ] 3.83 sec. 2025-10-09 12:04:25 00926_zookeeper_adaptive_index_granularity_replicated_merge_tree_long: [ OK ] 13.86 sec. 2025-10-09 12:04:26 01471_top_k_range_check: [ OK ] 0.74 sec. 2025-10-09 12:04:28 03151_dynamic_type_scale_max_types: [ OK ] 1.59 sec. 2025-10-09 12:04:28 02563_progress_when_no_rows_from_prewhere: [ SKIPPED ] 0.00 sec. 2025-10-09 12:04:28 Reason: not running for current build 2025-10-09 12:04:29 00991_system_parts_race_condition_long: [ OK ] 33.48 sec. 2025-10-09 12:04:29 02486_truncate_and_unexpected_parts: [ OK ] 3.82 sec. 2025-10-09 12:04:30 00086_concat_nary_const_with_nonconst_segfault: [ OK ] 1.78 sec. 2025-10-09 12:04:30 02451_variadic_null_garbage_data: [ OK ] 1.03 sec. 2025-10-09 12:04:30 00975_sample_prewhere_distributed: [ OK ] 0.78 sec. 2025-10-09 12:04:31 02354_vector_search_legacy_index_compatibility: [ OK ] 0.83 sec. 2025-10-09 12:04:33 02428_index_analysis_with_null_literal: [ OK ] 2.38 sec. 2025-10-09 12:04:35 02859_replicated_db_name_zookeeper: [ OK ] 4.84 sec. 2025-10-09 12:04:36 02366_kql_native_interval_format: [ OK ] 0.78 sec. 2025-10-09 12:04:36 01600_remerge_sort_lowered_memory_bytes_ratio: [ OK ] 2.83 sec. 2025-10-09 12:04:36 02324_compatibility_setting: [ OK ] 5.94 sec. 2025-10-09 12:04:36 01651_lc_insert_tiny_log_2: [ OK ] 13.75 sec. 2025-10-09 12:04:36 02269_to_start_of_interval_overflow: [ OK ] 0.58 sec. 2025-10-09 12:04:37 00932_array_intersect_bug: [ OK ] 0.62 sec. 2025-10-09 12:04:37 01710_force_use_projection: [ OK ] 0.83 sec. 2025-10-09 12:04:38 01787_arena_assert_column_nothing: [ OK ] 0.53 sec. 2025-10-09 12:04:39 00550_join_insert_select: [ OK ] 2.78 sec. 2025-10-09 12:04:40 01282_system_parts_ttl_info: [ OK ] 0.63 sec. 2025-10-09 12:04:41 01508_format_regexp_raw: [ OK ] 3.03 sec. 2025-10-09 12:04:41 02225_hints_for_indeices: [ OK ] 4.43 sec. 2025-10-09 12:04:41 00232_format_readable_decimal_size: [ OK ] 0.52 sec. 2025-10-09 12:04:41 03130_analyzer_self_join_group_by: [ OK ] 0.87 sec. 2025-10-09 12:04:44 01881_join_on_conditions_hash: [ OK ] 3.28 sec. 2025-10-09 12:04:45 00609_distributed_with_case_when_then: [ OK ] 0.77 sec. 2025-10-09 12:04:46 02293_h3_line: [ OK ] 0.92 sec. 2025-10-09 12:04:46 02473_multistep_split_prewhere: [ OK ] 54.58 sec. 2025-10-09 12:04:47 02392_every_setting_must_have_documentation: [ OK ] 0.57 sec. 2025-10-09 12:04:47 02687_native_fuzz: [ OK ] 0.62 sec. 2025-10-09 12:04:47 00552_logical_functions_uint8_as_bool: [ OK ] 0.58 sec. 2025-10-09 12:04:48 02242_throw_if_constant_argument: [ OK ] 0.57 sec. 2025-10-09 12:04:48 03204_distributed_with_scalar_subquery: [ OK ] 0.67 sec. 2025-10-09 12:04:49 00808_not_optimize_predicate: [ OK ] 1.13 sec. 2025-10-09 12:04:49 01359_codeql: [ OK ] 0.68 sec. 2025-10-09 12:04:49 02017_columns_with_dot: [ OK ] 0.78 sec. 2025-10-09 12:04:50 01910_view_dictionary_check_refresh: [ OK ] 25.37 sec. 2025-10-09 12:04:51 00834_limit_with_constant_expressions: [ OK ] 1.03 sec. 2025-10-09 12:04:51 02496_row_binary_large_string_size: [ OK ] 2.23 sec. 2025-10-09 12:04:52 01444_create_table_drop_database_race: [ OK ] 11.96 sec. 2025-10-09 12:04:52 02472_segfault_expression_parser: [ OK ] 0.57 sec. 2025-10-09 12:04:52 00906_low_cardinality_rollup: [ OK ] 0.72 sec. 2025-10-09 12:04:52 03155_explain_current_transaction: [ OK ] 0.57 sec. 2025-10-09 12:04:52 00591_columns_removal_union_all: [ OK ] 0.57 sec. 2025-10-09 12:04:53 01283_strict_resize_bug: [ OK ] 3.33 sec. 2025-10-09 12:04:53 00653_monotonic_integer_cast: [ OK ] 0.62 sec. 2025-10-09 12:04:53 00746_sql_fuzzy: [ OK ] 81.96 sec. 2025-10-09 12:04:54 02992_analyzer_group_by_const: [ OK ] 1.03 sec. 2025-10-09 12:04:54 03246_alter_update_dynamic_hung: [ OK ] 1.63 sec. 2025-10-09 12:04:55 02944_variant_as_common_type_analyzer: [ OK ] 1.23 sec. 2025-10-09 12:04:55 00633_materialized_view_and_too_many_parts_zookeeper: [ OK ] 13.16 sec. 2025-10-09 12:04:55 02421_truncate_isolation_with_mutations: [ OK ] 40.76 sec. 2025-10-09 12:04:55 00697_in_subquery_shard: [ OK ] 1.17 sec. 2025-10-09 12:04:55 03041_analyzer_gigachad_join: [ OK ] 0.72 sec. 2025-10-09 12:04:57 02458_insert_select_progress_tcp: [ OK ] 4.64 sec. 2025-10-09 12:04:58 03148_async_queries_in_query_log_errors: [ OK ] 5.34 sec. 2025-10-09 12:04:58 02973_parse_crlf_with_tsv_files: [ OK ] 3.03 sec. 2025-10-09 12:04:58 02461_prewhere_row_level_policy_lightweight_delete: [ OK ] 3.18 sec. 2025-10-09 12:04:59 02243_ipv6_long_parsing: [ OK ] 0.67 sec. 2025-10-09 12:04:59 00625_arrays_in_nested: [ OK ] 1.07 sec. 2025-10-09 12:05:00 00563_shard_insert_into_remote: [ OK ] 0.72 sec. 2025-10-09 12:05:00 02439_merge_selecting_partitions: [ OK ] 5.24 sec. 2025-10-09 12:05:01 00687_insert_into_mv: [ OK ] 0.73 sec. 2025-10-09 12:05:01 01747_alter_partition_key_enum_zookeeper_long: [ OK ] 1.13 sec. 2025-10-09 12:05:01 01071_prohibition_secondary_index_with_old_format_merge_tree: [ OK ] 0.67 sec. 2025-10-09 12:05:02 01101_literal_column_clash: [ OK ] 0.82 sec. 2025-10-09 12:05:02 00234_disjunctive_equality_chains_optimization: [ OK ] 0.63 sec. 2025-10-09 12:05:02 01081_demangle: [ OK ] 0.53 sec. 2025-10-09 12:05:03 03020_output_format_client: [ OK ] 5.03 sec. 2025-10-09 12:05:03 01381_for_each_with_states: [ OK ] 0.74 sec. 2025-10-09 12:05:03 02021_create_database_with_comment: [ OK ] 6.49 sec. 2025-10-09 12:05:04 02423_insert_stats_behaviour: [ OK ] 8.95 sec. 2025-10-09 12:05:04 02715_or_null: [ OK ] 0.68 sec. 2025-10-09 12:05:04 02313_test_fpc_codec: [ OK ] 1.18 sec. 2025-10-09 12:05:04 00974_adaptive_granularity_secondary_index: [ OK ] 2.19 sec. 2025-10-09 12:05:04 03155_datasketches_ubsan: [ OK ] 0.53 sec. 2025-10-09 12:05:04 03215_view_with_recursive: [ OK ] 1.23 sec. 2025-10-09 12:05:05 01322_cast_keep_nullable: [ OK ] 0.73 sec. 2025-10-09 12:05:05 02464_decimal_scale_buffer_overflow: [ OK ] 0.67 sec. 2025-10-09 12:05:05 00997_extract_all_crash_6627: [ OK ] 0.53 sec. 2025-10-09 12:05:05 01825_type_json_from_map: [ OK ] 5.69 sec. 2025-10-09 12:05:05 01917_prewhere_column_type: [ OK ] 0.87 sec. 2025-10-09 12:05:05 01052_array_reduce_exception: [ OK ] 0.57 sec. 2025-10-09 12:05:05 02922_respect_nulls_parser: [ OK ] 0.92 sec. 2025-10-09 12:05:05 00969_roundDuration: [ OK ] 0.68 sec. 2025-10-09 12:05:06 03274_dynamic_column_data_race_with_concurrent_hj: [ OK ] 0.57 sec. 2025-10-09 12:05:06 00552_logical_functions_simple: [ OK ] 0.72 sec. 2025-10-09 12:05:06 01825_type_json_3: [ OK ] 1.32 sec. 2025-10-09 12:05:07 01377_supertype_low_cardinality: [ OK ] 1.18 sec. 2025-10-09 12:05:07 00957_neighbor: [ OK ] 1.18 sec. 2025-10-09 12:05:07 02151_hash_table_sizes_stats_distributed: [ SKIPPED ] 0.00 sec. 2025-10-09 12:05:07 Reason: not running for current build 2025-10-09 12:05:07 01262_low_cardinality_remove: [ OK ] 0.73 sec. 2025-10-09 12:05:07 02734_big_int_from_float_ubsan: [ OK ] 0.58 sec. 2025-10-09 12:05:07 00908_bloom_filter_index: [ OK ] 30.56 sec. 2025-10-09 12:05:08 03038_nested_dynamic_merges_compact_vertical: [ SKIPPED ] 0.00 sec. 2025-10-09 12:05:08 Reason: not running for current build 2025-10-09 12:05:08 02577_keepermap_delete_update: [ OK ] 1.28 sec. 2025-10-09 12:05:08 00041_aggregation_remap: [ OK ] 0.63 sec. 2025-10-09 12:05:09 02207_s3_content_type: [ OK ] 3.13 sec. 2025-10-09 12:05:09 01319_query_formatting_in_server_log: [ OK ] 2.08 sec. 2025-10-09 12:05:09 00149_function_url_hash: [ OK ] 0.78 sec. 2025-10-09 12:05:09 00098_l_union_all: [ OK ] 0.68 sec. 2025-10-09 12:05:09 02785_global_join_too_many_columns: [ OK ] 0.68 sec. 2025-10-09 12:05:10 00538_datediff_plural_units: [ OK ] 0.68 sec. 2025-10-09 12:05:10 03032_storage_memory_modify_settings: [ OK ] 1.43 sec. 2025-10-09 12:05:11 00204_extract_url_parameter: [ OK ] 0.53 sec. 2025-10-09 12:05:11 00379_system_processes_port: [ OK ] 1.63 sec. 2025-10-09 12:05:11 00008_array_join: [ OK ] 0.53 sec. 2025-10-09 12:05:11 01149_zookeeper_mutation_stuck_after_replace_partition: [ OK ] 2.63 sec. 2025-10-09 12:05:12 01753_optimize_aggregation_in_order: [ OK ] 2.18 sec. 2025-10-09 12:05:12 01600_encode_XML: [ OK ] 0.57 sec. 2025-10-09 12:05:12 02910_object-json-crash-add-column: [ OK ] 0.98 sec. 2025-10-09 12:05:13 02991_count_rewrite_analyzer: [ OK ] 0.63 sec. 2025-10-09 12:05:13 02343_aggregation_pipeline: [ OK ] 1.23 sec. 2025-10-09 12:05:13 00088_distinct_of_arrays_of_strings: [ OK ] 0.53 sec. 2025-10-09 12:05:14 03041_select_with_query_result: [ OK ] 0.68 sec. 2025-10-09 12:05:14 02592_avro_more_types: [ OK ] 2.33 sec. 2025-10-09 12:05:14 02149_schema_inference_formats_with_schema_3: [ OK ] 6.54 sec. 2025-10-09 12:05:14 00743_limit_by_not_found_column: [ OK ] 0.73 sec. 2025-10-09 12:05:15 01458_count_digits: [ OK ] 0.73 sec. 2025-10-09 12:05:15 03166_optimize_row_order_during_insert: [ OK ] 1.03 sec. 2025-10-09 12:05:15 00205_scalar_subqueries: [ OK ] 0.98 sec. 2025-10-09 12:05:17 00688_low_cardinality_syntax: [ OK ] 1.18 sec. 2025-10-09 12:05:17 02879_use_structure_from_insertion_table_with_defaults: [ OK ] 2.24 sec. 2025-10-09 12:05:17 02932_group_by_null_fuzzer: [ OK ] 0.63 sec. 2025-10-09 12:05:18 02158_ztest: [ OK ] 0.68 sec. 2025-10-09 12:05:20 02993_lazy_index_loading: [ OK ] 4.94 sec. 2025-10-09 12:05:20 01515_logtrace_function: [ OK ] 1.98 sec. 2025-10-09 12:05:20 01010_partial_merge_join: [ OK ] 3.69 sec. 2025-10-09 12:05:21 03008_deduplication_wrong_mv: [ OK ] 0.63 sec. 2025-10-09 12:05:21 01651_lc_insert_tiny_log_1: [ OK ] 14.51 sec. 2025-10-09 12:05:21 00753_quantile_format: [ OK ] 0.88 sec. 2025-10-09 12:05:21 01011_group_uniq_array_memsan: [ OK ] 0.52 sec. 2025-10-09 12:05:21 00258_materializing_tuples: [ OK ] 0.58 sec. 2025-10-09 12:05:22 01663_quantile_weighted_overflow: [ OK ] 0.57 sec. 2025-10-09 12:05:22 01655_test_isnull_mysql_dialect: [ OK ] 0.57 sec. 2025-10-09 12:05:22 00966_invalid_json_must_not_parse: [ OK ] 0.63 sec. 2025-10-09 12:05:22 02031_format_query_option: [ OK ] 1.63 sec. 2025-10-09 12:05:23 01906_partition_by_multiply_by_zero: [ OK ] 0.73 sec. 2025-10-09 12:05:24 01064_pm_all_join_const_and_nullable: [ OK ] 1.83 sec. 2025-10-09 12:05:24 02963_remote_read_small_buffer_size_bug: [ OK ] 18.52 sec. 2025-10-09 12:05:24 02383_schema_inference_hints: [ OK ] 0.58 sec. 2025-10-09 12:05:25 01428_h3_range_check: [ OK ] 0.78 sec. 2025-10-09 12:05:25 02584_compressor_codecs: [ OK ] 3.53 sec. 2025-10-09 12:05:26 01187_set_profile_as_setting: [ OK ] 2.78 sec. 2025-10-09 12:05:26 01798_having_push_down: [ OK ] 0.68 sec. 2025-10-09 12:05:26 02771_if_constant_folding: [ OK ] 0.52 sec. 2025-10-09 12:05:26 03037_dynamic_merges_2_vertical_compact_merge_tree: [ SKIPPED ] 0.00 sec. 2025-10-09 12:05:26 Reason: not running for current build 2025-10-09 12:05:27 01650_expressions_merge_bug: [ OK ] 0.52 sec. 2025-10-09 12:05:27 03199_has_lc_fixed_string: [ OK ] 0.58 sec. 2025-10-09 12:05:27 00446_clear_column_in_partition_concurrent_zookeeper: [ OK ] 32.11 sec. 2025-10-09 12:05:27 02132_client_history_navigation: [ OK ] 2.18 sec. 2025-10-09 12:05:27 00606_quantiles_and_nans: [ OK ] 0.58 sec. 2025-10-09 12:05:28 00280_hex_escape_sequence: [ OK ] 0.57 sec. 2025-10-09 12:05:28 02721_url_cluster: [ OK ] 1.38 sec. 2025-10-09 12:05:29 03038_ambiguous_column: [ OK ] 0.77 sec. 2025-10-09 12:05:29 02844_table_function_url_filter_by_virtual_columns: [ OK ] 2.23 sec. 2025-10-09 12:05:29 01940_totimezone_operator_monotonicity: [ OK ] 0.62 sec. 2025-10-09 12:05:30 03274_format_inference_create_query_file: [ OK ] 2.28 sec. 2025-10-09 12:05:30 02554_log_faminy_support_storage_policy: [ OK ] 0.82 sec. 2025-10-09 12:05:30 01470_columns_transformers: [ OK ] 1.08 sec. 2025-10-09 12:05:30 02006_test_positional_arguments_on_cluster: [ OK ] 0.98 sec. 2025-10-09 12:05:30 03126_column_not_under_group_by: [ OK ] 0.58 sec. 2025-10-09 12:05:31 02022_storage_filelog_one_file: [ OK ] 7.04 sec. 2025-10-09 12:05:31 01031_pmj_new_any_semi_join: [ OK ] 0.93 sec. 2025-10-09 12:05:31 03100_analyzer_constants_in_multiif: [ OK ] 0.68 sec. 2025-10-09 12:05:31 01040_dictionary_invalidate_query_switchover_long: [ OK ] 19.28 sec. 2025-10-09 12:05:32 00444_join_use_nulls: [ OK ] 0.89 sec. 2025-10-09 12:05:32 03010_view_prewhere_in: [ OK ] 0.68 sec. 2025-10-09 12:05:32 02923_join_use_nulls_modulo: [ OK ] 0.63 sec. 2025-10-09 12:05:33 01558_transform_null_in: [ OK ] 0.93 sec. 2025-10-09 12:05:33 02358_file_default_value: [ OK ] 3.03 sec. 2025-10-09 12:05:33 02737_sql_auto_is_null: [ OK ] 0.58 sec. 2025-10-09 12:05:34 00953_indices_alter_exceptions: [ OK ] 4.14 sec. 2025-10-09 12:05:35 01825_new_type_json_3: [ OK ] 1.88 sec. 2025-10-09 12:05:35 01504_rocksdb: [ OK ] 5.64 sec. 2025-10-09 12:05:36 02956_rocksdb_with_ttl: [ OK ] 3.78 sec. 2025-10-09 12:05:36 02228_unquoted_dates_in_csv_schema_inference: [ OK ] 1.88 sec. 2025-10-09 12:05:36 00688_low_cardinality_dictionary_deserialization: [ OK ] 4.39 sec. 2025-10-09 12:05:37 00950_test_gorilla_codec: [ OK ] 1.03 sec. 2025-10-09 12:05:37 02243_make_date32: [ OK ] 1.53 sec. 2025-10-09 12:05:37 00534_functions_bad_arguments1: [ OK ] 15.62 sec. 2025-10-09 12:05:37 02096_date_time_1970_saturation: [ OK ] 1.03 sec. 2025-10-09 12:05:38 02366_normalize_aggregate_function_types_and_states: [ OK ] 0.68 sec. 2025-10-09 12:05:38 02246_clickhouse_local_drop_database: [ OK ] 2.93 sec. 2025-10-09 12:05:38 01051_window_view_parser_hop: [ OK ] 1.09 sec. 2025-10-09 12:05:39 02476_analyzer_join_with_unused_columns: [ OK ] 0.73 sec. 2025-10-09 12:05:39 02661_quantile_approx: [ OK ] 1.48 sec. 2025-10-09 12:05:39 02932_kill_query_sleep: [ OK ] 5.69 sec. 2025-10-09 12:05:40 00551_parse_or_null: [ OK ] 0.73 sec. 2025-10-09 12:05:40 01355_alter_column_with_order: [ OK ] 0.88 sec. 2025-10-09 12:05:40 00679_replace_asterisk: [ OK ] 0.73 sec. 2025-10-09 12:05:41 01925_json_as_string_data_in_square_brackets: [ OK ] 0.73 sec. 2025-10-09 12:05:41 02710_protobuf_ipv4_date32: [ OK ] 2.98 sec. 2025-10-09 12:05:41 02702_allow_skip_errors_enum: [ OK ] 3.90 sec. 2025-10-09 12:05:41 01567_system_processes_current_database: [ OK ] 0.63 sec. 2025-10-09 12:05:41 02154_bitmap_contains: [ OK ] 0.62 sec. 2025-10-09 12:05:42 01600_min_max_compress_block_size: [ OK ] 0.73 sec. 2025-10-09 12:05:42 01923_ttl_with_modify_column: [ OK ] 0.98 sec. 2025-10-09 12:05:42 01655_sleep_infinite_float: [ OK ] 0.63 sec. 2025-10-09 12:05:43 01020_function_array_compact: [ OK ] 0.93 sec. 2025-10-09 12:05:44 01750_parsing_exception: [ OK ] 2.23 sec. 2025-10-09 12:05:44 02707_analyzer_nested_lambdas_types: [ OK ] 0.58 sec. 2025-10-09 12:05:44 02267_empty_arrays_read_reverse: [ OK ] 1.93 sec. 2025-10-09 12:05:44 02287_ephemeral_format_crash: [ OK ] 0.63 sec. 2025-10-09 12:05:45 02479_analyzer_aggregation_crash: [ OK ] 0.73 sec. 2025-10-09 12:05:45 03080_analyzer_prefer_column_name_to_alias__virtual_columns: [ OK ] 0.68 sec. 2025-10-09 12:05:45 02354_read_in_order_prewhere: [ OK ] 4.24 sec. 2025-10-09 12:05:45 00619_extract: [ OK ] 0.78 sec. 2025-10-09 12:05:46 00952_part_frozen_info: [ OK ] 0.93 sec. 2025-10-09 12:05:46 03016_analyzer_groupby_fuzz_59796: [ OK ] 0.63 sec. 2025-10-09 12:05:46 00384_column_aggregate_function_insert_from: [ OK ] 1.18 sec. 2025-10-09 12:05:46 00022_func_higher_order_and_constants: [ OK ] 0.58 sec. 2025-10-09 12:05:46 01825_new_type_json_11: [ OK ] 8.00 sec. 2025-10-09 12:05:47 00530_arrays_of_nothing: [ OK ] 0.78 sec. 2025-10-09 12:05:47 00064_negate_bug: [ OK ] 0.63 sec. 2025-10-09 12:05:47 02535_ip_parser_not_whole: [ OK ] 0.68 sec. 2025-10-09 12:05:47 02813_func_now_and_alias: [ OK ] 0.63 sec. 2025-10-09 12:05:47 00803_odbc_driver_2_format: [ OK ] 0.64 sec. 2025-10-09 12:05:48 00800_function_java_hash: [ OK ] 0.78 sec. 2025-10-09 12:05:48 02481_analyzer_optimize_aggregation_arithmetics: [ OK ] 1.83 sec. 2025-10-09 12:05:49 01010_pmj_skip_blocks: [ OK ] 3.44 sec. 2025-10-09 12:05:49 01605_key_condition_enum_int: [ OK ] 0.73 sec. 2025-10-09 12:05:49 01498_alter_column_storage_memory: [ OK ] 0.68 sec. 2025-10-09 12:05:50 02114_bool_type: [ OK ] 0.84 sec. 2025-10-09 12:05:50 00072_in_types: [ OK ] 0.63 sec. 2025-10-09 12:05:50 02982_create_mv_inner_extra: [ OK ] 0.69 sec. 2025-10-09 12:05:51 01001_rename_merge_race_condition: [ OK ] 14.27 sec. 2025-10-09 12:05:51 01545_url_file_format_settings: [ OK ] 0.93 sec. 2025-10-09 12:05:52 02478_window_frame_type_groups: [ OK ] 0.67 sec. 2025-10-09 12:05:52 02943_order_by_all: [ OK ] 1.38 sec. 2025-10-09 12:05:52 00719_insert_block_without_column: [ OK ] 4.54 sec. 2025-10-09 12:05:52 02918_analyzer_to_ast_crash: [ OK ] 0.68 sec. 2025-10-09 12:05:52 00178_query_datetime64_index: [ OK ] 0.63 sec. 2025-10-09 12:05:53 02382_analyzer_matcher_join_using: [ OK ] 1.28 sec. 2025-10-09 12:05:53 02574_suspicious_low_cardinality_msan: [ OK ] 0.98 sec. 2025-10-09 12:05:54 00426_nulls_sorting: [ OK ] 0.83 sec. 2025-10-09 12:05:54 02311_system_zookeeper_insert: [ OK ] 1.18 sec. 2025-10-09 12:05:55 01307_polygon_perimeter: [ OK ] 0.58 sec. 2025-10-09 12:05:55 02681_undrop_query_uuid: [ OK ] 7.85 sec. 2025-10-09 12:05:55 01716_drop_rename_sign_column: [ OK ] 0.57 sec. 2025-10-09 12:05:56 02973_analyzer_join_use_nulls_column_not_found: [ OK ] 0.83 sec. 2025-10-09 12:05:56 02718_cli_dashed_options_parsing: [ OK ] 5.14 sec. 2025-10-09 12:05:56 00300_csv: [ OK ] 0.63 sec. 2025-10-09 12:05:56 00841_temporary_table_database: [ OK ] 0.63 sec. 2025-10-09 12:05:57 02568_json_array_length: [ OK ] 0.83 sec. 2025-10-09 12:05:58 01804_uniq_up_to_ubsan: [ OK ] 0.63 sec. 2025-10-09 12:05:58 00111_shard_external_sort_distributed: [ OK ] 44.80 sec. 2025-10-09 12:05:59 02095_function_get_os_kernel_version: [ OK ] 0.53 sec. 2025-10-09 12:05:59 01666_merge_tree_max_query_limit: [ OK ] 10.75 sec. 2025-10-09 12:05:59 02595_orc_arrow_parquet_more_types: [ OK ] 3.68 sec. 2025-10-09 12:06:00 02561_sorting_constants_and_distinct_crash: [ OK ] 7.39 sec. 2025-10-09 12:06:00 00307_format_xml: [ OK ] 0.62 sec. 2025-10-09 12:06:00 02842_filesystem_cache_validate_path: [ OK ] 0.63 sec. 2025-10-09 12:06:00 01474_custom_null_tsv: [ OK ] 3.93 sec. 2025-10-09 12:06:01 01037_zookeeper_check_table_empty_pk: [ OK ] 0.73 sec. 2025-10-09 12:06:01 02375_pretty_formats: [ OK ] 0.77 sec. 2025-10-09 12:06:01 02525_different_engines_in_temporary_tables: [ OK ] 0.83 sec. 2025-10-09 12:06:01 00061_merge_tree_alter: [ OK ] 1.33 sec. 2025-10-09 12:06:02 01831_max_streams: [ OK ] 0.52 sec. 2025-10-09 12:06:03 02565_analyzer_limit_settings: [ OK ] 0.83 sec. 2025-10-09 12:06:04 02737_arrayJaccardIndex: [ OK ] 1.13 sec. 2025-10-09 12:06:05 02811_csv_input_field_type_mismatch: [ OK ] 3.94 sec. 2025-10-09 12:06:05 02716_int256_arrayfunc: [ OK ] 0.83 sec. 2025-10-09 12:06:05 02122_parallel_formatting_PrettyCompactNoEscapes: [ OK ] 7.50 sec. 2025-10-09 12:06:05 02228_merge_tree_insert_memory_usage: [ OK ] 3.68 sec. 2025-10-09 12:06:05 01053_drop_database_mat_view: [ OK ] 0.73 sec. 2025-10-09 12:06:06 03273_dictionary_rbac: [ OK ] 5.29 sec. 2025-10-09 12:06:06 00939_limit_by_offset: [ OK ] 0.63 sec. 2025-10-09 12:06:06 00667_compare_arrays_of_different_types: [ OK ] 0.63 sec. 2025-10-09 12:06:06 03018_analyzer_distributed_query_with_positional_arguments: [ OK ] 0.68 sec. 2025-10-09 12:06:07 03198_bit_shift_throws_error_for_out_of_bounds: [ OK ] 1.13 sec. 2025-10-09 12:06:08 02899_distributed_limit_by: [ OK ] 1.94 sec. 2025-10-09 12:06:08 03209_json_type_horizontal_merges: [ SKIPPED ] 0.00 sec. 2025-10-09 12:06:08 Reason: not running for current build 2025-10-09 12:06:09 00823_capnproto_input: [ OK ] 4.04 sec. 2025-10-09 12:06:10 03206_no_exceptions_clickhouse_local: [ FAIL ] 1.84 sec. 2025-10-09 12:06:10 Reason: return code: 134, result: 2025-10-09 12:06:10 2025-10-09 12:06:10 2025-10-09 12:06:10 2025-10-09 12:06:10 stdout: 2025-10-09 12:06:10 2025-10-09 12:06:10 2025-10-09 12:06:10 Settings used in the test: --max_insert_threads 2 --group_by_two_level_threshold 65199 --group_by_two_level_threshold_bytes 50000000 --distributed_aggregation_memory_efficient 0 --fsync_metadata 1 --output_format_parallel_formatting 0 --input_format_parallel_parsing 0 --min_chunk_bytes_for_parallel_parsing 11951249 --max_read_buffer_size 588120 --prefer_localhost_replica 1 --max_block_size 14651 --max_joined_block_size_rows 99975 --max_threads 3 --optimize_append_index 0 --optimize_if_chain_to_multiif 0 --optimize_if_transform_strings_to_enum 1 --optimize_read_in_order 0 --optimize_or_like_chain 0 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 0 --read_in_order_two_level_merge_threshold 8 --optimize_aggregation_in_order 0 --aggregation_in_order_max_block_bytes 47528614 --use_uncompressed_cache 0 --min_bytes_to_use_direct_io 10737418240 --min_bytes_to_use_mmap_io 1 --local_filesystem_read_method mmap --remote_filesystem_read_method read --local_filesystem_read_prefetch 0 --filesystem_cache_segments_batch_size 10 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 0 --throw_on_error_from_cache_on_write_operations 0 --remote_filesystem_read_prefetch 1 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 64Mi --filesystem_prefetches_limit 0 --filesystem_prefetch_min_bytes_for_single_read_task 1Mi --filesystem_prefetch_step_marks 0 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 1 --compile_sort_description 0 --merge_tree_coarse_index_granularity 23 --optimize_distinct_in_order 1 --max_bytes_before_external_sort 7299901035 --max_bytes_before_external_group_by 0 --max_bytes_before_remerge_sort 1058849539 --min_compress_block_size 3081968 --max_compress_block_size 2033360 --merge_tree_compact_parts_min_granules_to_multibuffer_read 57 --optimize_sorting_by_input_stream_properties 1 --http_response_buffer_size 3200777 --http_wait_end_of_query False --enable_memory_bound_merging_of_aggregation_results 0 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 3 --min_count_to_compile_sort_description 3 --session_timezone Africa/Juba --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction False --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.78 --prefer_external_sort_block_bytes 100000000 --cross_join_min_rows_to_compress 0 --cross_join_min_bytes_to_compress 1 --min_external_table_block_size_bytes 0 --max_parsing_threads 0 --optimize_functions_to_subcolumns 0 --parallel_replicas_local_plan 1 2025-10-09 12:06:10 2025-10-09 12:06:10 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 0.9622528022052642 --prefer_fetch_merged_part_size_threshold 10737418240 --vertical_merge_algorithm_min_rows_to_activate 1 --vertical_merge_algorithm_min_columns_to_activate 100 --allow_vertical_merges_from_compact_to_wide_parts 1 --min_merge_bytes_to_use_direct_io 10737418240 --index_granularity_bytes 8377163 --merge_max_block_size 15148 --index_granularity 51027 --min_bytes_for_wide_part 1073741824 --marks_compress_block_size 90500 --primary_key_compress_block_size 77141 --replace_long_file_name_to_hash 1 --max_file_name_length 49 --min_bytes_for_full_part_storage 0 --compact_parts_max_bytes_to_buffer 449770096 --compact_parts_max_granules_to_buffer 1 --compact_parts_merge_max_bytes_to_prefetch_part 32638814 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 71 --old_parts_lifetime 480 2025-10-09 12:06:10 2025-10-09 12:06:10 Database: test_cpdvfnrd 2025-10-09 12:06:10 02012_zookeeper_changed_enum_type: [ OK ] 0.83 sec. 2025-10-09 12:06:11 02967_analyzer_fuzz: [ OK ] 0.88 sec. 2025-10-09 12:06:12 00754_alter_modify_column_partitions: [ OK ] 1.68 sec. 2025-10-09 12:06:12 01939_network_receive_bytes_metrics: [ OK ] 5.09 sec. 2025-10-09 12:06:12 03262_analyzer_materialized_view_in_with_cte: [ OK ] 0.68 sec. 2025-10-09 12:06:12 02237_lzma_bug: [ OK ] 7.04 sec. 2025-10-09 12:06:13 02474_extract_fixedstring_from_json: [ OK ] 0.68 sec. 2025-10-09 12:06:13 01799_long_uniq_theta_sketch: [ OK ] 6.54 sec. 2025-10-09 12:06:13 02782_values_null_to_lc_nullable: [ OK ] 0.52 sec. 2025-10-09 12:06:13 00903_array_with_constant_function: [ OK ] 0.52 sec. 2025-10-09 12:06:14 03047_analyzer_alias_join: [ OK ] 0.57 sec. 2025-10-09 12:06:14 01014_function_repeat_corner_cases: [ OK ] 0.73 sec. 2025-10-09 12:06:15 02475_join_bug_42832: [ OK ] 0.78 sec. 2025-10-09 12:06:15 01376_array_fill_empty: [ OK ] 0.58 sec. 2025-10-09 12:06:16 01198_client_quota_key: [ OK ] 2.63 sec. 2025-10-09 12:06:16 02751_query_log_test_partitions: [ OK ] 2.08 sec. 2025-10-09 12:06:16 02982_dont_infer_exponent_floats: [ OK ] 0.63 sec. 2025-10-09 12:06:16 01353_topk_enum: [ OK ] 0.63 sec. 2025-10-09 12:06:17 01882_scalar_subquery_exception: [ OK ] 0.67 sec. 2025-10-09 12:06:17 00740_database_in_nested_view: [ OK ] 0.83 sec. 2025-10-09 12:06:17 02030_rocksdb_race_long: [ OK ] 23.04 sec. 2025-10-09 12:06:18 00534_functions_bad_arguments7: [ OK ] 18.87 sec. 2025-10-09 12:06:18 00740_optimize_predicate_expression: [ OK ] 0.68 sec. 2025-10-09 12:06:18 01289_min_execution_speed_not_too_early: [ OK ] 2.68 sec. 2025-10-09 12:06:18 02713_array_low_cardinality_string: [ OK ] 0.63 sec. 2025-10-09 12:06:19 02026_accurate_cast_or_default: [ OK ] 1.28 sec. 2025-10-09 12:06:19 03001_block_offset_column: [ OK ] 1.34 sec. 2025-10-09 12:06:19 02098_date32_comparison: [ OK ] 0.78 sec. 2025-10-09 12:06:19 02012_changed_enum_type_non_replicated: [ OK ] 0.73 sec. 2025-10-09 12:06:19 02477_age: [ OK ] 1.28 sec. 2025-10-09 12:06:19 02476_fix_cast_parser_bug: [ OK ] 0.48 sec. 2025-10-09 12:06:19 02364_window_case: [ OK ] 0.58 sec. 2025-10-09 12:06:20 02864_statistics_delayed_materialization_in_merge: [ OK ] 0.93 sec. 2025-10-09 12:06:20 01923_different_expression_name_alias: [ OK ] 0.73 sec. 2025-10-09 12:06:20 03247_generic_arrayMin_arrayMax_fixes: [ OK ] 0.83 sec. 2025-10-09 12:06:21 01427_pk_and_expression_with_different_type: [ OK ] 0.52 sec. 2025-10-09 12:06:21 00098_j_union_all: [ OK ] 0.57 sec. 2025-10-09 12:06:21 02371_create_temporary_table_as_with_columns_list: [ OK ] 0.53 sec. 2025-10-09 12:06:21 02456_keeper_retries_during_insert: [ OK ] 2.18 sec. 2025-10-09 12:06:21 01925_jit_aggregation_function_count_long: [ OK ] 0.73 sec. 2025-10-09 12:06:22 02501_analyzer_expired_context_crash_fix: [ OK ] 0.78 sec. 2025-10-09 12:06:22 02276_full_sort_join_unsupported: [ OK ] 0.94 sec. 2025-10-09 12:06:22 03013_group_by_use_nulls_with_materialize_and_analyzer: [ OK ] 0.68 sec. 2025-10-09 12:06:22 02183_dictionary_date_types: [ OK ] 1.58 sec. 2025-10-09 12:06:23 02306_window_move_row_number_fix: [ OK ] 0.58 sec. 2025-10-09 12:06:23 02233_interpolate_1: [ OK ] 1.48 sec. 2025-10-09 12:06:23 02695_logical_optimizer_alias_bug: [ OK ] 0.73 sec. 2025-10-09 12:06:24 02267_output_format_prometheus: [ OK ] 0.88 sec. 2025-10-09 12:06:25 01556_explain_select_with_union_query: [ OK ] 1.23 sec. 2025-10-09 12:06:25 01854_HTTP_dict_decompression: [ OK ] 2.88 sec. 2025-10-09 12:06:25 03031_filter_float64_logical_error: [ OK ] 0.69 sec. 2025-10-09 12:06:25 03036_dynamic_read_shared_subcolumns_compact_merge_tree: [ SKIPPED ] 0.00 sec. 2025-10-09 12:06:25 Reason: not running for current build 2025-10-09 12:06:25 03014_msan_parse_date_time: [ OK ] 0.63 sec. 2025-10-09 12:06:26 01419_merge_tree_settings_sanity_check: [ OK ] 0.93 sec. 2025-10-09 12:06:26 00819_ast_refactoring_bugs: [ OK ] 0.78 sec. 2025-10-09 12:06:26 03152_trailing_comma_in_columns_list_in_insert: [ OK ] 0.68 sec. 2025-10-09 12:06:27 02112_skip_index_set_and_or: [ OK ] 0.73 sec. 2025-10-09 12:06:28 03290_final_collapsing: [ OK ] 1.23 sec. 2025-10-09 12:06:29 02842_largestTriangleThreeBuckets_aggregate_function: [ OK ] 1.53 sec. 2025-10-09 12:06:29 00996_neighbor: [ OK ] 1.24 sec. 2025-10-09 12:06:30 00055_join_two_numbers: [ OK ] 0.73 sec. 2025-10-09 12:06:30 03226_alter_update_dynamic_json_not_supported: [ OK ] 0.73 sec. 2025-10-09 12:06:30 02915_sleep_large_uint: [ OK ] 0.73 sec. 2025-10-09 12:06:31 00268_aliases_without_as_keyword: [ OK ] 0.73 sec. 2025-10-09 12:06:32 02676_kafka_murmur_hash: [ OK ] 0.63 sec. 2025-10-09 12:06:33 02577_analyzer_array_join_calc_twice: [ OK ] 0.79 sec. 2025-10-09 12:06:35 02346_fulltext_index_search: [ OK ] 15.82 sec. 2025-10-09 12:06:35 01411_xor_itai_shirav: [ OK ] 0.59 sec. 2025-10-09 12:06:38 02269_bool_map_sync_after_error: [ OK ] 7.95 sec. 2025-10-09 12:06:38 02992_all_columns_should_have_comment: [ OK ] 2.24 sec. 2025-10-09 12:06:38 00829_bitmap_function: [ OK ] 5.12 sec. 2025-10-09 12:06:38 03071_analyzer_array_join_forbid_non_existing_columns: [ OK ] 0.59 sec. 2025-10-09 12:06:39 02559_add_parts: [ OK ] 0.84 sec. 2025-10-09 12:06:39 01917_system_data_skipping_indices: [ OK ] 0.85 sec. 2025-10-09 12:06:39 02246_flatten_tuple: [ OK ] 0.78 sec. 2025-10-09 12:06:40 00814_parsing_ub: [ OK ] 0.63 sec. 2025-10-09 12:06:40 02560_count_digits: [ OK ] 0.98 sec. 2025-10-09 12:06:41 00073_merge_sorting_empty_array_joined: [ OK ] 0.69 sec. 2025-10-09 12:06:41 02901_remove_nullable_crash_analyzer: [ OK ] 0.73 sec. 2025-10-09 12:06:42 00732_quorum_insert_lost_part_and_alive_part_zookeeper_long: [ OK ] 1.94 sec. 2025-10-09 12:06:42 03208_array_of_json_read_subcolumns_2_wide_merge_tree: [ SKIPPED ] 0.00 sec. 2025-10-09 12:06:42 Reason: not running for current build 2025-10-09 12:06:42 02539_vertical_merge_compact_parts: [ OK ] 3.39 sec. 2025-10-09 12:06:42 02540_duplicate_primary_key2: [ OK ] 0.78 sec. 2025-10-09 12:06:43 02481_analyzer_optimize_grouping_sets_keys: [ OK ] 0.68 sec. 2025-10-09 12:06:43 01746_test_for_tupleElement_must_be_constant_issue: [ OK ] 1.33 sec. 2025-10-09 12:06:44 01505_pipeline_executor_UAF: [ OK ] 21.52 sec. 2025-10-09 12:06:44 03037_union_view: [ OK ] 0.93 sec. 2025-10-09 12:06:44 01655_quarter_modificator_for_formatDateTime: [ OK ] 0.58 sec. 2025-10-09 12:06:45 01119_session_log: [ OK ] 32.27 sec. 2025-10-09 12:06:45 00609_prewhere_and_default: [ OK ] 1.68 sec. 2025-10-09 12:06:45 00726_materialized_view_concurrent: [ OK ] 0.73 sec. 2025-10-09 12:06:45 02424_pod_array_overflow: [ OK ] 0.53 sec. 2025-10-09 12:06:46 01472_many_rows_in_totals: [ OK ] 1.03 sec. 2025-10-09 12:06:47 02122_4letter_words_stress_zookeeper: [ OK ] 22.56 sec. 2025-10-09 12:06:48 00913_many_threads: [ OK ] 4.34 sec. 2025-10-09 12:06:48 00265_http_content_type_format_timezone: [ OK ] 3.23 sec. 2025-10-09 12:06:50 01893_jit_aggregation_function_min_long: [ OK ] 2.79 sec. 2025-10-09 12:06:50 02723_param_exception_message_context: [ OK ] 2.13 sec. 2025-10-09 12:06:51 02240_get_type_serialization_streams: [ OK ] 0.73 sec. 2025-10-09 12:06:51 01045_array_zip: [ OK ] 0.93 sec. 2025-10-09 12:06:52 02006_client_test_hint_error_name: [ OK ] 0.63 sec. 2025-10-09 12:06:52 02931_ubsan_error_arena_aligned_alloc: [ OK ] 0.58 sec. 2025-10-09 12:06:52 01683_dist_INSERT_block_structure_mismatch: [ OK ] 0.68 sec. 2025-10-09 12:06:52 02421_type_json_async_insert: [ OK ] 5.99 sec. 2025-10-09 12:06:53 00862_decimal_in: [ OK ] 1.03 sec. 2025-10-09 12:06:53 00267_tuple_array_access_operators_priority: [ OK ] 0.59 sec. 2025-10-09 12:06:53 02874_toDaysSinceYearZero: [ OK ] 1.03 sec. 2025-10-09 12:06:54 02677_grace_hash_limit_race: [ OK ] 0.78 sec. 2025-10-09 12:06:54 02833_std_alias: [ OK ] 0.63 sec. 2025-10-09 12:06:55 03290_limit_by_segv: [ OK ] 0.63 sec. 2025-10-09 12:06:55 00098_1_union_all: [ OK ] 1.03 sec. 2025-10-09 12:06:56 02242_if_then_else_null_bug: [ OK ] 0.73 sec. 2025-10-09 12:06:57 02952_clickhouse_local_query_parameters_cli: [ OK ] 1.94 sec. 2025-10-09 12:06:57 00492_drop_temporary_table: [ OK ] 0.63 sec. 2025-10-09 12:06:58 02980_s3_plain_DROP_TABLE_ReplicatedMergeTree: [ OK ] 4.99 sec. 2025-10-09 12:07:00 01358_mutation_delete_null_rows: [ OK ] 1.54 sec. 2025-10-09 12:07:01 00372_cors_header: [ OK ] 1.68 sec. 2025-10-09 12:07:02 02477_s3_request_throttler: [ OK ] 4.94 sec. 2025-10-09 12:07:03 01780_column_sparse_distinct: [ OK ] 1.24 sec. 2025-10-09 12:07:03 02521_tsv_csv_custom_header_detection: [ OK ] 21.23 sec. 2025-10-09 12:07:04 00487_if_array_fixed_string: [ OK ] 0.68 sec. 2025-10-09 12:07:04 02967_parallel_replicas_join_algo_and_analyzer_1: [ OK ] 15.51 sec. 2025-10-09 12:07:04 01690_quantilesTiming_ubsan: [ OK ] 0.58 sec. 2025-10-09 12:07:04 02966_nested_offsets_subcolumn: [ OK ] 2.74 sec. 2025-10-09 12:07:04 00109_shard_totals_after_having: [ OK ] 7.45 sec. 2025-10-09 12:07:04 02233_with_total_empty_chunk: [ OK ] 0.58 sec. 2025-10-09 12:07:05 02207_ttl_move_if_exists: [ OK ] 0.53 sec. 2025-10-09 12:07:05 01866_bit_positions_to_array: [ OK ] 1.08 sec. 2025-10-09 12:07:05 02176_optimize_aggregation_in_order_empty: [ OK ] 0.73 sec. 2025-10-09 12:07:05 01043_categorical_iv: [ OK ] 0.98 sec. 2025-10-09 12:07:05 00999_join_on_expression: [ OK ] 1.28 sec. 2025-10-09 12:07:06 01825_new_type_json_add_column: [ OK ] 0.88 sec. 2025-10-09 12:07:06 03152_join_filter_push_down_equivalent_columns: [ OK ] 0.78 sec. 2025-10-09 12:07:07 01035_prewhere_with_alias: [ OK ] 0.68 sec. 2025-10-09 12:07:07 01532_collate_in_low_cardinality: [ OK ] 0.88 sec. 2025-10-09 12:07:07 02142_http_with_query_parameters: [ OK ] 1.58 sec. 2025-10-09 12:07:08 01603_read_with_backoff_bug: [ OK ] 88.84 sec. 2025-10-09 12:07:08 01956_skip_unavailable_shards_excessive_attempts: [ OK ] 3.23 sec. 2025-10-09 12:07:09 00310_tskv: [ OK ] 3.83 sec. 2025-10-09 12:07:09 00134_aggregation_by_fixed_string_of_size_1_2_4_8: [ OK ] 0.73 sec. 2025-10-09 12:07:09 02374_combine_multi_if_and_count_if_opt: [ OK ] 0.57 sec. 2025-10-09 12:07:10 01802_formatDateTime_DateTime64_century: [ OK ] 0.68 sec. 2025-10-09 12:07:10 00356_analyze_aggregations_and_union_all: [ OK ] 0.65 sec. 2025-10-09 12:07:10 02359_send_logs_source_regexp: [ OK ] 2.08 sec. 2025-10-09 12:07:10 01019_alter_materialized_view_atomic: [ OK ] 59.56 sec. 2025-10-09 12:07:10 03033_final_undefined_last_mark: [ OK ] 0.32 sec. 2025-10-09 12:07:11 01710_projections_order_by_complete: [ OK ] 0.73 sec. 2025-10-09 12:07:11 02122_parallel_formatting_Values: [ OK ] 4.19 sec. 2025-10-09 12:07:11 01063_create_column_set: [ OK ] 0.57 sec. 2025-10-09 12:07:11 03148_asof_join_ddb_subquery: [ OK ] 0.63 sec. 2025-10-09 12:07:11 03197_storage_join_strictness_type_restriction: [ OK ] 0.68 sec. 2025-10-09 12:07:11 02884_parquet_new_encodings: [ OK ] 1.88 sec. 2025-10-09 12:07:12 00930_arrayIntersect: [ OK ] 0.98 sec. 2025-10-09 12:07:12 02842_one_input_format: [ OK ] 5.14 sec. 2025-10-09 12:07:12 01701_clear_projection_and_part_remove: [ OK ] 0.83 sec. 2025-10-09 12:07:13 02724_persist_interval_type: [ OK ] 0.83 sec. 2025-10-09 12:07:13 03456_match_index_prefix_extraction: [ OK ] 1.88 sec. 2025-10-09 12:07:13 02556_local_with_totals_and_extremes: [ OK ] 1.93 sec. 2025-10-09 12:07:13 03002_modify_query_cte: [ OK ] 0.58 sec. 2025-10-09 12:07:14 02112_delayed_clickhouse_local: [ OK ] 1.93 sec. 2025-10-09 12:07:14 00700_decimal_null: [ OK ] 1.33 sec. 2025-10-09 12:07:14 02500_analyzer_storage_view_crash_fix: [ OK ] 0.88 sec. 2025-10-09 12:07:14 01445_create_table_as_table_function: [ OK ] 3.13 sec. 2025-10-09 12:07:14 02232_partition_pruner_mixed_constant_type: [ OK ] 0.63 sec. 2025-10-09 12:07:15 00395_nullable: [ OK ] 7.60 sec. 2025-10-09 12:07:15 00033_fixed_string_to_string: [ OK ] 0.58 sec. 2025-10-09 12:07:15 01852_s2_get_neighbours: [ OK ] 0.57 sec. 2025-10-09 12:07:15 03271_decimal_monotonic_day_of_week: [ OK ] 0.63 sec. 2025-10-09 12:07:15 00136_duplicate_order_by_elems: [ OK ] 0.73 sec. 2025-10-09 12:07:15 01043_dictionary_attribute_properties_values: [ OK ] 0.68 sec. 2025-10-09 12:07:16 00568_empty_function_with_fixed_string: [ OK ] 0.68 sec. 2025-10-09 12:07:16 01786_group_by_pk_many_streams: [ OK ] 1.43 sec. 2025-10-09 12:07:16 03095_merge_and_buffer_tables: [ OK ] 0.83 sec. 2025-10-09 12:07:17 01060_defaults_all_columns: [ OK ] 0.73 sec. 2025-10-09 12:07:17 01300_svg: [ OK ] 1.48 sec. 2025-10-09 12:07:19 02500_bson_read_object_id: [ OK ] 2.23 sec. 2025-10-09 12:07:20 02783_date_predicate_optimizations: [ OK ] 5.44 sec. 2025-10-09 12:07:20 02311_create_table_with_unknown_format: [ OK ] 1.01 sec. 2025-10-09 12:07:21 01461_query_start_time_microseconds: [ OK ] 5.34 sec. 2025-10-09 12:07:22 02861_alter_replace_partition_do_not_wait_mutations_on_unrelated_partitions: [ OK ] 8.80 sec. 2025-10-09 12:07:22 02845_arrayShiftRotate: [ OK ] 1.89 sec. 2025-10-09 12:07:23 02235_check_table_sparse_serialization: [ OK ] 0.91 sec. 2025-10-09 12:07:23 02293_http_header_full_summary_without_progress: [ OK ] 2.79 sec. 2025-10-09 12:07:24 02421_json_decimals_as_strings: [ OK ] 0.90 sec. 2025-10-09 12:07:24 02751_protobuf_ipv6: [ OK ] 2.55 sec. 2025-10-09 12:07:24 03003_compatibility_setting_bad_value: [ OK ] 0.54 sec. 2025-10-09 12:07:24 00380_client_break_at_exception_in_batch_mode: [ OK ] 2.23 sec. 2025-10-09 12:07:25 00357_to_string_complex_types: [ OK ] 0.73 sec. 2025-10-09 12:07:25 01264_nested_baloo_bear: [ OK ] 0.99 sec. 2025-10-09 12:07:25 01144_multiword_data_types: [ OK ] 1.17 sec. 2025-10-09 12:07:25 02551_ipv4_implicit_uint64: [ OK ] 0.64 sec. 2025-10-09 12:07:25 00577_full_join_segfault: [ OK ] 0.75 sec. 2025-10-09 12:07:26 02374_in_tuple_index: [ OK ] 0.68 sec. 2025-10-09 12:07:26 02845_domain_rfc_support_ipv6: [ OK ] 0.98 sec. 2025-10-09 12:07:26 00956_join_use_nulls_with_array_column: [ OK ] 0.69 sec. 2025-10-09 12:07:26 01832_memory_write_suffix: [ OK ] 0.73 sec. 2025-10-09 12:07:27 01532_primary_key_without_order_by_zookeeper: [ OK ] 1.58 sec. 2025-10-09 12:07:27 01906_bigint_accurate_cast_ubsan: [ OK ] 1.13 sec. 2025-10-09 12:07:28 02346_to_hour_monotonicity_fix: [ OK ] 1.38 sec. 2025-10-09 12:07:29 02834_array_exists_segfault: [ OK ] 0.63 sec. 2025-10-09 12:07:30 02553_new_type_json_attach_partition: [ OK ] 1.03 sec. 2025-10-09 12:07:31 03014_group_by_use_nulls_injective_functions_and_analyzer: [ OK ] 0.90 sec. 2025-10-09 12:07:32 01925_date_date_time_comparison: [ OK ] 0.60 sec. 2025-10-09 12:07:32 01307_orc_output_format: [ OK ] 5.74 sec. 2025-10-09 12:07:32 03165_order_by_duplicate: [ OK ] 0.64 sec. 2025-10-09 12:07:33 02421_simple_queries_for_opentelemetry: [ OK ] 17.57 sec. 2025-10-09 12:07:33 03032_scalars_create_as_select: [ OK ] 0.89 sec. 2025-10-09 12:07:34 00981_in_subquery_with_tuple: [ OK ] 7.80 sec. 2025-10-09 12:07:34 03119_analyzer_window_function_in_CTE_alias: [ OK ] 0.88 sec. 2025-10-09 12:07:34 00753_alter_destination_for_storage_buffer: [ OK ] 1.83 sec. 2025-10-09 12:07:34 02421_truncate_isolation_no_merges: [ OK ] 49.61 sec. 2025-10-09 12:07:34 02908_filesystem_cache_as_collection: [ OK ] 0.81 sec. 2025-10-09 12:07:35 01079_new_range_reader_segfault: [ OK ] 0.85 sec. 2025-10-09 12:07:35 01710_order_by_projections_incomplete: [ OK ] 0.81 sec. 2025-10-09 12:07:36 01047_no_alias_columns_with_table_aliases: [ OK ] 1.05 sec. 2025-10-09 12:07:36 02967_parallel_replicas_join_algo_and_analyzer_2: [ OK ] 23.39 sec. 2025-10-09 12:07:36 01785_pmj_lc_bug: [ OK ] 1.14 sec. 2025-10-09 12:07:36 02918_implicit_sign_column_constraints_for_collapsing_engine: [ OK ] 8.98 sec. 2025-10-09 12:07:36 02559_multiple_read_steps_in_prewhere_fuzz: [ OK ] 0.68 sec. 2025-10-09 12:07:37 02594_msgpack_more_types: [ OK ] 2.69 sec. 2025-10-09 12:07:37 01549_low_cardinality_materialized_view: [ OK ] 0.68 sec. 2025-10-09 12:07:38 00538_datediff: [ OK ] 1.28 sec. 2025-10-09 12:07:38 01272_suspicious_codecs: [ OK ] 1.78 sec. 2025-10-09 12:07:38 03038_recursive_cte_postgres_4: [ OK ] 0.88 sec. 2025-10-09 12:07:38 02372_analyzer_join: [ OK ] 20.49 sec. 2025-10-09 12:07:38 00213_multiple_global_in: [ OK ] 0.58 sec. 2025-10-09 12:07:38 03217_fliter_pushdown_no_keys: [ OK ] 0.78 sec. 2025-10-09 12:07:39 01668_avg_weighted_ubsan: [ OK ] 0.58 sec. 2025-10-09 12:07:39 02724_mutliple_storage_join: [ OK ] 0.68 sec. 2025-10-09 12:07:39 01710_projection_drop_if_exists: [ OK ] 0.68 sec. 2025-10-09 12:07:40 03107_ill_formed_select_in_materialized_view: [ OK ] 0.68 sec. 2025-10-09 12:07:40 00876_wrong_arraj_join_column: [ OK ] 0.57 sec. 2025-10-09 12:07:41 01054_random_printable_ascii_ubsan: [ OK ] 5.31 sec. 2025-10-09 12:07:42 02809_prewhere_and_in: [ OK ] 1.08 sec. 2025-10-09 12:07:42 00484_preferred_max_column_in_block_size_bytes: [ OK ] 3.73 sec. 2025-10-09 12:07:42 02921_file_engine_size_virtual_column: [ OK ] 2.93 sec. 2025-10-09 12:07:42 00956_http_prepared_statements: [ OK ] 1.73 sec. 2025-10-09 12:07:43 01388_multi_if_optimization: [ OK ] 0.57 sec. 2025-10-09 12:07:43 01529_bad_memory_tracking: [ OK ] 6.44 sec. 2025-10-09 12:07:43 03215_validate_type_in_alter_add_modify_column: [ OK ] 0.98 sec. 2025-10-09 12:07:44 00500_point_in_polygon_non_const_poly: [ OK ] 1.98 sec. 2025-10-09 12:07:44 02231_hierarchical_dictionaries_constant: [ OK ] 0.98 sec. 2025-10-09 12:07:44 02784_disable_async_with_dedup_correctly: [ OK ] 10.31 sec. 2025-10-09 12:07:44 01691_DateTime64_clamp: [ OK ] 0.73 sec. 2025-10-09 12:07:44 01797_StripeLog_rwlock_ub: [ OK ] 0.62 sec. 2025-10-09 12:07:45 00804_test_custom_compression_codecs: [ OK ] 2.38 sec. 2025-10-09 12:07:45 01838_system_dictionaries_virtual_key_column: [ OK ] 0.68 sec. 2025-10-09 12:07:45 03273_dynamic_pretty_json_serialization: [ OK ] 0.67 sec. 2025-10-09 12:07:46 02177_sum_if_not_found: [ OK ] 0.93 sec. 2025-10-09 12:07:48 01822_short_circuit: [ OK ] 3.09 sec. 2025-10-09 12:07:48 02016_bit_shift_right_for_string_integer: [ OK ] 2.28 sec. 2025-10-09 12:07:49 03210_empty_tuple_lhs_of_in: [ OK ] 0.57 sec. 2025-10-09 12:07:49 00417_kill_query: [ OK ] 5.49 sec. 2025-10-09 12:07:49 01505_log_distributed_deadlock: [ OK ] 0.62 sec. 2025-10-09 12:07:50 03015_aggregator_empty_data_multiple_blocks: [ OK ] 0.57 sec. 2025-10-09 12:07:50 02535_analyzer_limit_offset: [ OK ] 0.57 sec. 2025-10-09 12:07:51 01891_partition_hash_no_long_int: [ OK ] 0.93 sec. 2025-10-09 12:07:52 01681_hyperscan_debug_assertion: [ OK ] 2.63 sec. 2025-10-09 12:07:52 01121_remote_scalar_subquery: [ OK ] 0.68 sec. 2025-10-09 12:07:53 02480_suspicious_lowcard_in_key: [ OK ] 0.68 sec. 2025-10-09 12:07:53 01825_new_type_json_parallel_insert: [ OK ] 1.23 sec. 2025-10-09 12:07:54 01442_h3kring_range_check: [ OK ] 0.72 sec. 2025-10-09 12:07:54 01330_array_join_in_higher_order_function: [ OK ] 0.52 sec. 2025-10-09 12:07:55 01674_clickhouse_client_query_param_cte: [ OK ] 2.13 sec. 2025-10-09 12:07:55 02801_backup_native_copy: [ OK ] 12.07 sec. 2025-10-09 12:07:56 02113_base64encode_trailing_bytes_1: [ OK ] 0.52 sec. 2025-10-09 12:07:56 02886_binary_like: [ OK ] 0.83 sec. 2025-10-09 12:07:57 00516_deduplication_after_drop_partition_zookeeper: [ OK ] 0.98 sec. 2025-10-09 12:07:58 00116_storage_set: [ OK ] 0.88 sec. 2025-10-09 12:07:58 00715_fetch_merged_or_mutated_part_zookeeper: [ OK ] 12.46 sec. 2025-10-09 12:07:59 02922_respect_nulls_Nullable: [ OK ] 1.23 sec. 2025-10-09 12:07:59 02903_client_insert_in_background: [ OK ] 3.48 sec. 2025-10-09 12:08:00 00405_output_format_pretty_color: [ OK ] 1.08 sec. 2025-10-09 12:08:01 01930_optimize_skip_unused_shards_rewrite_in: [ OK ] 2.13 sec. 2025-10-09 12:08:01 01030_limit_by_with_ties_error: [ OK ] 3.43 sec. 2025-10-09 12:08:02 02456_aggregate_state_conversion: [ OK ] 0.58 sec. 2025-10-09 12:08:02 00976_system_stop_ttl_merges: [ OK ] 1.73 sec. 2025-10-09 12:08:02 02962_indexHint_rpn_construction: [ OK ] 0.58 sec. 2025-10-09 12:08:03 02540_date_column_consistent_insert_behaviour: [ OK ] 1.63 sec. 2025-10-09 12:08:03 02011_normalize_utf8: [ OK ] 1.13 sec. 2025-10-09 12:08:04 00506_union_distributed: [ OK ] 1.18 sec. 2025-10-09 12:08:04 03205_json_cast_from_string: [ OK ] 0.88 sec. 2025-10-09 12:08:04 03209_json_type_vertical_merges: [ SKIPPED ] 0.00 sec. 2025-10-09 12:08:04 Reason: not running for current build 2025-10-09 12:08:04 00131_set_hashed: [ OK ] 0.52 sec. 2025-10-09 12:08:04 00800_versatile_storage_join: [ OK ] 1.03 sec. 2025-10-09 12:08:05 01386_negative_float_constant_key_condition: [ OK ] 0.73 sec. 2025-10-09 12:08:05 03039_dynamic_collapsing_merge_tree: [ OK ] 20.98 sec. 2025-10-09 12:08:05 01018_Distributed__shard_num: [ OK ] 1.63 sec. 2025-10-09 12:08:05 01519_topK_distributed_parametrized: [ OK ] 0.93 sec. 2025-10-09 12:08:06 00647_histogram: [ OK ] 0.63 sec. 2025-10-09 12:08:06 00964_bloom_index_string_functions: [ OK ] 18.12 sec. 2025-10-09 12:08:06 03212_thousand_exceptions: [ OK ] 28.10 sec. 2025-10-09 12:08:06 02813_any_value: [ OK ] 0.68 sec. 2025-10-09 12:08:06 01669_test_toYear_mysql_dialect: [ OK ] 0.52 sec. 2025-10-09 12:08:06 01120_join_constants: [ OK ] 0.68 sec. 2025-10-09 12:08:06 01062_pm_all_join_with_block_continuation: [ OK ] 30.15 sec. 2025-10-09 12:08:06 02100_now64_types_bug: [ OK ] 0.58 sec. 2025-10-09 12:08:06 01413_alter_update_supertype: [ OK ] 0.68 sec. 2025-10-09 12:08:06 01293_external_sorting_limit_bug: [ OK ] 0.67 sec. 2025-10-09 12:08:06 01664_decimal_ubsan: [ OK ] 0.53 sec. 2025-10-09 12:08:07 01710_minmax_count_projection_modify_partition_key: [ OK ] 0.68 sec. 2025-10-09 12:08:07 02915_analyzer_fuzz_6: [ OK ] 0.83 sec. 2025-10-09 12:08:07 02784_schema_inference_null_as_default: [ OK ] 0.58 sec. 2025-10-09 12:08:07 03303_alias_inverse_order: [ OK ] 0.63 sec. 2025-10-09 12:08:07 00700_decimal_formats: [ OK ] 0.78 sec. 2025-10-09 12:08:08 01670_distributed_bytes_to_throw_insert: [ OK ] 0.78 sec. 2025-10-09 12:08:08 01719_join_timezone: [ OK ] 0.83 sec. 2025-10-09 12:08:08 01866_view_persist_settings: [ OK ] 1.53 sec. 2025-10-09 12:08:09 02967_fuzz_bad_cast: [ OK ] 0.63 sec. 2025-10-09 12:08:09 00832_storage_file_lock: [ OK ] 0.63 sec. 2025-10-09 12:08:09 00700_decimal_casts: [ OK ] 2.89 sec. 2025-10-09 12:08:10 01731_async_task_queue_wait: [ OK ] 3.33 sec. 2025-10-09 12:08:10 03013_ignore_drop_queries_probability: [ OK ] 0.88 sec. 2025-10-09 12:08:10 00449_filter_array_nullable_tuple: [ OK ] 0.68 sec. 2025-10-09 12:08:10 00910_client_window_size_detection: [ OK ] 2.43 sec. 2025-10-09 12:08:11 01416_clear_column_pk: [ OK ] 0.78 sec. 2025-10-09 12:08:11 02025_having_filter_column: [ OK ] 0.63 sec. 2025-10-09 12:08:11 00804_rollup_with_having: [ OK ] 0.68 sec. 2025-10-09 12:08:11 01450_set_null_const: [ OK ] 0.63 sec. 2025-10-09 12:08:12 02967_parallel_replicas_joins_and_analyzer: [ OK ] 5.74 sec. 2025-10-09 12:08:12 00882_multiple_join_no_alias: [ OK ] 1.08 sec. 2025-10-09 12:08:12 01039_row_policy_dcl: [ OK ] 2.23 sec. 2025-10-09 12:08:13 02596_build_set_and_remote: [ OK ] 1.68 sec. 2025-10-09 12:08:14 01581_deduplicate_by_columns_local: [ OK ] 1.98 sec. 2025-10-09 12:08:14 02285_hex_bin_support_more_types: [ OK ] 0.87 sec. 2025-10-09 12:08:14 01278_format_multiple_queries: [ OK ] 1.78 sec. 2025-10-09 12:08:14 03228_dynamic_serializations_uninitialized_value: [ OK ] 0.68 sec. 2025-10-09 12:08:15 01156_pcg_deserialization: [ OK ] 20.43 sec. 2025-10-09 12:08:15 02186_range_hashed_dictionary_intersecting_intervals: [ OK ] 1.03 sec. 2025-10-09 12:08:15 02455_improve_feedback_when_replacing_partition_with_different_primary_key: [ OK ] 0.77 sec. 2025-10-09 12:08:16 02864_statistics_predicates: [ OK ] 4.04 sec. 2025-10-09 12:08:17 00387_use_client_time_zone: [ OK ] 2.23 sec. 2025-10-09 12:08:17 03287_dynamic_and_json_squashing_fix: [ OK ] 0.98 sec. 2025-10-09 12:08:17 01095_tpch_like_smoke: [ OK ] 2.68 sec. 2025-10-09 12:08:18 01051_same_name_alias_with_joins: [ OK ] 0.78 sec. 2025-10-09 12:08:19 00210_insert_select_extremes_http: [ OK ] 1.73 sec. 2025-10-09 12:08:19 02454_disable_mergetree_with_lightweight_delete_column: [ OK ] 0.88 sec. 2025-10-09 12:08:20 01770_add_months_ubsan: [ OK ] 0.63 sec. 2025-10-09 12:08:20 02815_alias_to_length: [ OK ] 0.62 sec. 2025-10-09 12:08:20 02444_async_broken_outdated_part_loading: [ OK ] 11.15 sec. 2025-10-09 12:08:20 02554_invalid_create_view_syntax: [ OK ] 0.53 sec. 2025-10-09 12:08:21 02233_optimize_aggregation_in_order_prefix: [ OK ] 0.88 sec. 2025-10-09 12:08:21 01470_explain: [ OK ] 0.67 sec. 2025-10-09 12:08:21 01528_to_uuid_or_null_or_zero: [ OK ] 0.98 sec. 2025-10-09 12:08:22 02250_ON_CLUSTER_grant: [ OK ] 4.44 sec. 2025-10-09 12:08:22 02013_bloom_filter_hasAll: [ OK ] 1.03 sec. 2025-10-09 12:08:22 02674_trivial_count_analyzer: [ OK ] 1.13 sec. 2025-10-09 12:08:22 01535_decimal_round_scale_overflow_check: [ OK ] 0.68 sec. 2025-10-09 12:08:22 01049_join_low_card_bug_long: [ OK ] 15.22 sec. 2025-10-09 12:08:22 02007_ipv4_and_ipv6_to_and_from_string: [ OK ] 0.77 sec. 2025-10-09 12:08:23 03053_analyzer_join_alias: [ OK ] 0.58 sec. 2025-10-09 12:08:23 01421_array_nullable_element_nullable_index: [ OK ] 0.63 sec. 2025-10-09 12:08:23 01710_projection_aggregate_functions_null_for_empty: [ OK ] 0.62 sec. 2025-10-09 12:08:23 01497_mutation_support_for_storage_memory: [ OK ] 0.68 sec. 2025-10-09 12:08:24 01901_in_literal_shard_prune: [ OK ] 0.73 sec. 2025-10-09 12:08:24 02352_interactive_queries_from_file: [ OK ] 2.28 sec. 2025-10-09 12:08:24 02746_index_analysis_binary_operator_with_null: [ OK ] 0.72 sec. 2025-10-09 12:08:25 00346_if_tuple: [ OK ] 0.78 sec. 2025-10-09 12:08:25 01433_hex_float: [ OK ] 0.68 sec. 2025-10-09 12:08:25 01509_parallel_quorum_and_merge_long: [ OK ] 14.21 sec. 2025-10-09 12:08:25 02487_create_index_normalize_functions: [ OK ] 0.88 sec. 2025-10-09 12:08:25 01702_system_numbers_scientific_notation: [ OK ] 0.73 sec. 2025-10-09 12:08:26 02915_input_table_function_in_subquery: [ OK ] 2.73 sec. 2025-10-09 12:08:26 02251_alter_enum_nested_struct: [ OK ] 0.78 sec. 2025-10-09 12:08:26 00650_csv_with_specified_quote_rule: [ OK ] 11.45 sec. 2025-10-09 12:08:27 02493_max_streams_for_merge_tree_reading: [ OK ] 4.14 sec. 2025-10-09 12:08:27 01788_update_nested_type_subcolumn_check: [ OK ] 2.09 sec. 2025-10-09 12:08:27 00105_shard_collations: [ OK ] 0.98 sec. 2025-10-09 12:08:27 02990_optimize_uniq_to_count_alias: [ OK ] 0.72 sec. 2025-10-09 12:08:27 01021_only_tuple_columns: [ OK ] 0.87 sec. 2025-10-09 12:08:28 01813_quantileBfloat16_nans: [ OK ] 0.58 sec. 2025-10-09 12:08:28 01362_year_of_ISO8601_week_modificators_for_formatDateTime: [ OK ] 0.68 sec. 2025-10-09 12:08:28 02293_http_header_summary_contains_exception_code_with_progress: [ OK ] 2.65 sec. 2025-10-09 12:08:29 02125_transform_decimal_bug: [ OK ] 0.62 sec. 2025-10-09 12:08:29 00986_materialized_view_stack_overflow: [ OK ] 1.38 sec. 2025-10-09 12:08:29 01189_create_as_table_as_table_function: [ OK ] 0.73 sec. 2025-10-09 12:08:29 03054_analyzer_join_alias: [ OK ] 0.52 sec. 2025-10-09 12:08:30 02125_constant_if_condition_and_not_existing_column: [ OK ] 0.78 sec. 2025-10-09 12:08:30 02471_wrong_date_monotonicity: [ OK ] 0.63 sec. 2025-10-09 12:08:30 02864_restore_table_with_broken_part: [ OK ] 4.79 sec. 2025-10-09 12:08:31 01000_unneeded_substitutions_client: [ OK ] 2.23 sec. 2025-10-09 12:08:31 01512_create_replicate_merge_tree_one_arg: [ OK ] 0.52 sec. 2025-10-09 12:08:32 01076_predicate_optimizer_with_view: [ OK ] 0.68 sec. 2025-10-09 12:08:33 02012_compress_lz4: [ OK ] 2.53 sec. 2025-10-09 12:08:34 02975_intdiv_with_decimal: [ OK ] 1.23 sec. 2025-10-09 12:08:34 02841_parallel_final_wrong_columns_order: [ OK ] 2.23 sec. 2025-10-09 12:08:34 02873_s3_presigned_url_and_url_with_special_characters: [ OK ] 8.91 sec. 2025-10-09 12:08:34 00988_constraints_replication_zookeeper_long: [ OK ] 4.39 sec. 2025-10-09 12:08:35 00555_right_join_excessive_rows: [ OK ] 0.62 sec. 2025-10-09 12:08:35 00581_limit_on_result_and_subquery_and_insert: [ OK ] 0.73 sec. 2025-10-09 12:08:35 01622_constraints_where_optimization: [ OK ] 0.87 sec. 2025-10-09 12:08:35 02223_h3_test_const_columns: [ OK ] 1.08 sec. 2025-10-09 12:08:36 02280_add_query_level_settings: [ OK ] 0.57 sec. 2025-10-09 12:08:36 01784_parallel_formatting_memory: [ OK ] 0.83 sec. 2025-10-09 12:08:36 01077_mutations_index_consistency: [ OK ] 6.89 sec. 2025-10-09 12:08:36 02480_analyzer_alias_nullptr: [ OK ] 0.52 sec. 2025-10-09 12:08:36 00523_aggregate_functions_in_group_array: [ OK ] 0.53 sec. 2025-10-09 12:08:36 01118_is_constant: [ OK ] 0.62 sec. 2025-10-09 12:08:36 03092_analyzer_same_table_name_in_different_databases: [ OK ] 0.63 sec. 2025-10-09 12:08:37 02496_remove_redundant_sorting_analyzer: [ OK ] 22.39 sec. 2025-10-09 12:08:37 02910_nullable_enum_cast: [ OK ] 0.57 sec. 2025-10-09 12:08:38 02907_fromDaysSinceYearZero: [ OK ] 1.23 sec. 2025-10-09 12:08:38 00411_merge_tree_where_const_in_set: [ OK ] 0.73 sec. 2025-10-09 12:08:38 02341_global_join_cte: [ OK ] 1.03 sec. 2025-10-09 12:08:38 02188_table_function_format: [ OK ] 0.63 sec. 2025-10-09 12:08:39 02497_having_without_actual_aggregation_bug: [ OK ] 0.63 sec. 2025-10-09 12:08:40 02122_parallel_formatting_CustomSeparated: [ OK ] 5.04 sec. 2025-10-09 12:08:41 00104_totals_having_mode: [ OK ] 0.78 sec. 2025-10-09 12:08:41 01600_quota_by_forwarded_ip: [ OK ] 2.78 sec. 2025-10-09 12:08:41 01116_asof_join_dolbyzerr: [ OK ] 0.63 sec. 2025-10-09 12:08:43 02420_stracktrace_debug_symbols: [ OK ] 2.23 sec. 2025-10-09 12:08:44 00700_decimal_aggregates: [ OK ] 2.33 sec. 2025-10-09 12:08:44 02039_group_by_with_totals_having: [ OK ] 0.52 sec. 2025-10-09 12:08:44 01710_projection_with_nullable_keys: [ OK ] 0.52 sec. 2025-10-09 12:08:44 02789_functions_after_sorting_and_columns_with_same_names_bug: [ OK ] 0.78 sec. 2025-10-09 12:08:45 00497_whitespaces_in_insert: [ OK ] 9.35 sec. 2025-10-09 12:08:45 02096_totals_global_in_bug: [ OK ] 0.63 sec. 2025-10-09 12:08:45 00905_compile_expressions_compare_big_dates: [ OK ] 0.68 sec. 2025-10-09 12:08:46 00439_fixed_string_filter: [ OK ] 0.58 sec. 2025-10-09 12:08:46 02887_format_readable_timedelta_subseconds: [ OK ] 0.68 sec. 2025-10-09 12:08:47 03040_recursive_cte_postgres_6: [ OK ] 1.33 sec. 2025-10-09 12:08:47 00701_join_default_strictness: [ OK ] 0.78 sec. 2025-10-09 12:08:48 01079_alter_default_zookeeper_long: [ OK ] 1.43 sec. 2025-10-09 12:08:49 03095_join_filter_push_down_right_stream_filled: [ OK ] 0.78 sec. 2025-10-09 12:08:50 02354_parse_timedelta: [ OK ] 1.38 sec. 2025-10-09 12:08:51 02247_read_bools_as_numbers_json: [ OK ] 12.06 sec. 2025-10-09 12:08:51 01083_window_view_select: [ OK ] 5.49 sec. 2025-10-09 12:08:52 02426_orc_bug: [ OK ] 2.13 sec. 2025-10-09 12:08:53 01721_join_implicit_cast_long: [ OK ] 15.02 sec. 2025-10-09 12:08:53 01812_optimize_skip_unused_shards_single_node: [ OK ] 0.53 sec. 2025-10-09 12:08:53 02011_tuple_vector_functions: [ OK ] 2.63 sec. 2025-10-09 12:08:54 03447_grouping_sets_analyzer_const_columns: [ OK ] 0.68 sec. 2025-10-09 12:08:54 03142_untuple_crash: [ OK ] 0.57 sec. 2025-10-09 12:08:54 01090_fixed_string_bit_ops: [ OK ] 0.57 sec. 2025-10-09 12:08:55 03003_database_filesystem_format_detection: [ OK ] 2.13 sec. 2025-10-09 12:08:55 00910_zookeeper_test_alter_compression_codecs_long: [ OK ] 1.68 sec. 2025-10-09 12:08:56 00927_asof_join_noninclusive: [ OK ] 1.03 sec. 2025-10-09 12:08:56 02271_temporary_table_show_rows_bytes: [ OK ] 0.63 sec. 2025-10-09 12:08:56 01851_clear_column_referenced_by_mv: [ OK ] 0.68 sec. 2025-10-09 12:08:57 01508_explain_header: [ OK ] 0.53 sec. 2025-10-09 12:08:57 01508_query_obfuscator: [ OK ] 1.98 sec. 2025-10-09 12:08:58 01925_map_populate_series_on_map: [ OK ] 1.18 sec. 2025-10-09 12:08:58 02351_Map_combinator_dist: [ OK ] 1.08 sec. 2025-10-09 12:08:58 02790_client_max_opening_fd: [ OK ] 2.08 sec. 2025-10-09 12:08:58 02493_analyzer_sum_if_to_count_if: [ OK ] 0.68 sec. 2025-10-09 12:08:59 03032_save_bad_json_escape_sequences: [ OK ] 0.47 sec. 2025-10-09 12:08:59 00856_no_column_issue_4242: [ OK ] 0.63 sec. 2025-10-09 12:09:00 03227_dynamic_subcolumns_enumerate_streams: [ OK ] 0.58 sec. 2025-10-09 12:09:00 01640_distributed_async_insert_compression: [ OK ] 0.68 sec. 2025-10-09 12:09:00 01232_untuple: [ OK ] 0.77 sec. 2025-10-09 12:09:01 03145_asof_join_ddb_inequalities: [ OK ] 0.98 sec. 2025-10-09 12:09:01 01244_optimize_distributed_group_by_sharding_key: [ OK ] 2.93 sec. 2025-10-09 12:09:01 01774_tuple_null_in: [ OK ] 0.63 sec. 2025-10-09 12:09:02 02477_logical_expressions_optimizer_low_cardinality: [ OK ] 0.73 sec. 2025-10-09 12:09:02 02151_lc_prefetch: [ SKIPPED ] 0.00 sec. 2025-10-09 12:09:02 Reason: not running for current build 2025-10-09 12:09:02 01056_predicate_optimizer_bugs: [ OK ] 1.53 sec. 2025-10-09 12:09:03 03224_json_merges_new_type_in_shared_data: [ OK ] 0.93 sec. 2025-10-09 12:09:03 03041_dynamic_type_check_table: [ OK ] 16.22 sec. 2025-10-09 12:09:03 02932_punycode: [ OK ] 2.03 sec. 2025-10-09 12:09:03 02179_range_hashed_dictionary_invalid_interval: [ OK ] 0.73 sec. 2025-10-09 12:09:04 01442_merge_detach_attach_long: [ OK ] 33.77 sec. 2025-10-09 12:09:04 02681_aggregation_by_partitions_bug: [ OK ] 0.83 sec. 2025-10-09 12:09:04 02344_analyzer_multiple_aliases_for_expression: [ OK ] 0.82 sec. 2025-10-09 12:09:04 01851_hedged_connections_external_tables: [ OK ] 0.62 sec. 2025-10-09 12:09:04 03008_index_small: [ OK ] 0.63 sec. 2025-10-09 12:09:05 01104_distributed_numbers_test: [ OK ] 0.73 sec. 2025-10-09 12:09:05 02364_dictionary_datetime_64_attribute_crash: [ OK ] 0.67 sec. 2025-10-09 12:09:05 01410_nullable_key_and_index: [ OK ] 1.43 sec. 2025-10-09 12:09:05 01869_reinterpret_as_fixed_string_uuid: [ OK ] 0.53 sec. 2025-10-09 12:09:05 01463_resample_overflow: [ OK ] 0.58 sec. 2025-10-09 12:09:06 02972_parallel_replicas_cte: [ OK ] 1.23 sec. 2025-10-09 12:09:06 01013_hex_decimal: [ OK ] 0.57 sec. 2025-10-09 12:09:06 01423_if_nullable_cond: [ OK ] 0.58 sec. 2025-10-09 12:09:07 02366_asof_optimize_predicate_bug_37813: [ OK ] 0.68 sec. 2025-10-09 12:09:08 02442_auxiliary_zookeeper_endpoint_id: [ OK ] 0.93 sec. 2025-10-09 12:09:08 00674_join_on_syntax: [ OK ] 2.33 sec. 2025-10-09 12:09:08 01509_dictionary_preallocate: [ OK ] 2.23 sec. 2025-10-09 12:09:08 02133_distributed_queries_formatting: [ OK ] 0.58 sec. 2025-10-09 12:09:09 00580_cast_nullable_to_non_nullable: [ OK ] 0.57 sec. 2025-10-09 12:09:09 01457_order_by_nulls_first: [ OK ] 0.83 sec. 2025-10-09 12:09:10 01072_optimize_skip_unused_shards_const_expr_eval: [ OK ] 1.68 sec. 2025-10-09 12:09:10 00662_array_has_nullable: [ OK ] 1.18 sec. 2025-10-09 12:09:10 01165_lost_part_empty_partition: [ OK ] 5.34 sec. 2025-10-09 12:09:11 02691_multiple_joins_backtick_identifiers: [ OK ] 0.78 sec. 2025-10-09 12:09:11 01610_client_spawn_editor: [ OK ] 0.27 sec. 2025-10-09 12:09:11 01280_min_map_max_map: [ OK ] 1.18 sec. 2025-10-09 12:09:11 01663_aes_msan: [ OK ] 0.62 sec. 2025-10-09 12:09:13 01415_sticking_mutations: [ OK ] 36.47 sec. 2025-10-09 12:09:13 02475_analyzer_join_tree_subquery: [ OK ] 0.58 sec. 2025-10-09 12:09:13 02245_make_datetime64: [ OK ] 1.93 sec. 2025-10-09 12:09:14 01520_client_print_query_id: [ OK ] 2.23 sec. 2025-10-09 12:09:14 02455_duplicate_column_names_in_schema_inference: [ OK ] 0.57 sec. 2025-10-09 12:09:14 01470_columns_transformers2: [ OK ] 0.63 sec. 2025-10-09 12:09:15 00429_point_in_ellipses: [ OK ] 0.63 sec. 2025-10-09 12:09:15 01106_const_fixed_string_like: [ OK ] 0.98 sec. 2025-10-09 12:09:15 01776_decrypt_aead_size_check: [ OK ] 0.63 sec. 2025-10-09 12:09:15 03001_backup_matview_after_modify_query: [ OK ] 6.34 sec. 2025-10-09 12:09:16 02128_cast_nullable: [ OK ] 0.57 sec. 2025-10-09 12:09:16 01913_fix_column_transformer_replace_format: [ OK ] 0.53 sec. 2025-10-09 12:09:17 00732_quorum_insert_simple_test_1_parts_zookeeper_long: [ OK ] 1.23 sec. 2025-10-09 12:09:17 01115_prewhere_array_join: [ OK ] 1.63 sec. 2025-10-09 12:09:18 02366_kql_create_table: [ OK ] 0.83 sec. 2025-10-09 12:09:18 00135_duplicate_group_by_keys_segfault: [ OK ] 0.33 sec. 2025-10-09 12:09:19 00098_7_union_all: [ OK ] 0.68 sec. 2025-10-09 12:09:20 03039_dynamic_aggregating_merge_tree: [ OK ] 28.71 sec. 2025-10-09 12:09:20 02813_seriesDecomposeSTL: [ OK ] 1.13 sec. 2025-10-09 12:09:20 00340_squashing_insert_select: [ OK ] 4.79 sec. 2025-10-09 12:09:20 00632_aggregation_window_funnel: [ OK ] 2.74 sec. 2025-10-09 12:09:21 02931_alter_materialized_view_query_inconsistent: [ OK ] 0.68 sec. 2025-10-09 12:09:21 01425_decimal_parse_big_negative_exponent: [ OK ] 0.83 sec. 2025-10-09 12:09:21 00570_empty_array_is_const: [ OK ] 0.63 sec. 2025-10-09 12:09:21 01280_unicode_whitespaces_lexer: [ OK ] 0.68 sec. 2025-10-09 12:09:21 02010_array_index_bad_cast: [ OK ] 0.58 sec. 2025-10-09 12:09:21 00476_pretty_formats_and_widths: [ OK ] 0.63 sec. 2025-10-09 12:09:21 00564_initial_column_values_with_default_expression: [ OK ] 0.73 sec. 2025-10-09 12:09:22 00098_f_union_all: [ OK ] 0.68 sec. 2025-10-09 12:09:22 00009_array_join_subquery: [ OK ] 0.68 sec. 2025-10-09 12:09:22 02263_format_insert_settings: [ OK ] 8.65 sec. 2025-10-09 12:09:23 01676_range_hashed_dictionary: [ OK ] 1.63 sec. 2025-10-09 12:09:23 03130_convert_outer_join_to_inner_join: [ OK ] 0.93 sec. 2025-10-09 12:09:23 00339_parsing_bad_arrays: [ OK ] 1.78 sec. 2025-10-09 12:09:24 03299_deep_nested_map_creation: [ OK ] 0.78 sec. 2025-10-09 12:09:25 02015_async_inserts_2: [ OK ] 3.04 sec. 2025-10-09 12:09:26 01318_alter_add_column_exists: [ OK ] 0.68 sec. 2025-10-09 12:09:26 02317_distinct_in_order_optimization: [ OK ] 3.13 sec. 2025-10-09 12:09:27 00854_multiple_join_asterisks: [ OK ] 0.83 sec. 2025-10-09 12:09:27 02122_parallel_formatting_JSONCompactEachRowWithNamesAndTypes: [ OK ] 4.74 sec. 2025-10-09 12:09:27 02122_parallel_formatting_JSONCompactEachRowWithNames: [ OK ] 4.74 sec. 2025-10-09 12:09:27 03033_dist_settings.optimize_skip_unused_shards_rewrite_in_composite_sharding_key: [ OK ] 0.98 sec. 2025-10-09 12:09:28 03251_unaligned_window_function_state: [ OK ] 0.57 sec. 2025-10-09 12:09:28 00586_removing_unused_columns_from_subquery: [ OK ] 0.98 sec. 2025-10-09 12:09:29 02497_if_transform_strings_to_enum: [ OK ] 1.43 sec. 2025-10-09 12:09:29 01017_bithamming_distance: [ OK ] 0.88 sec. 2025-10-09 12:09:29 01526_param_uuid: [ OK ] 2.28 sec. 2025-10-09 12:09:29 00585_union_all_subquery_aggregation_column_removal: [ OK ] 1.13 sec. 2025-10-09 12:09:29 01273_arrow_decimal: [ OK ] 5.24 sec. 2025-10-09 12:09:30 03284_json_object_as_tuple_duplicate_keys: [ OK ] 0.68 sec. 2025-10-09 12:09:30 03325_distributed_join_json_array_subcolumns: [ OK ] 0.93 sec. 2025-10-09 12:09:30 00829_bitmap64_function: [ OK ] 1.28 sec. 2025-10-09 12:09:31 03034_dynamic_conversions: [ OK ] 1.38 sec. 2025-10-09 12:09:31 02880_indexHint__partition_id: [ OK ] 0.68 sec. 2025-10-09 12:09:31 01345_array_join_LittleMaverick: [ OK ] 0.73 sec. 2025-10-09 12:09:31 02840_grace_hash_join_structure_mismatch: [ OK ] 0.68 sec. 2025-10-09 12:09:31 00901_joint_entropy: [ OK ] 0.68 sec. 2025-10-09 12:09:32 01559_aggregate_null_for_empty_fix: [ OK ] 0.78 sec. 2025-10-09 12:09:32 01036_union_different_columns: [ OK ] 0.53 sec. 2025-10-09 12:09:33 01812_has_generic: [ OK ] 0.58 sec. 2025-10-09 12:09:33 00066_group_by_in: [ OK ] 0.62 sec. 2025-10-09 12:09:34 02176_toStartOfWeek_overflow_pruning: [ OK ] 0.83 sec. 2025-10-09 12:09:35 03214_count_distinct_null_key_memory_leak: [ OK ] 3.74 sec. 2025-10-09 12:09:35 00943_mv_rename_without_inner_table: [ OK ] 0.78 sec. 2025-10-09 12:09:35 02097_initializeAggregationNullable: [ OK ] 0.58 sec. 2025-10-09 12:09:36 00725_join_on_bug_3: [ OK ] 0.78 sec. 2025-10-09 12:09:37 02366_kql_func_ip: [ OK ] 5.10 sec. 2025-10-09 12:09:37 02842_vertical_merge_after_add_drop_column: [ OK ] 0.88 sec. 2025-10-09 12:09:37 00421_storage_merge__table_index: [ OK ] 26.85 sec. 2025-10-09 12:09:38 02376_analyzer_in_function_subquery: [ OK ] 0.98 sec. 2025-10-09 12:09:38 01273_arrow_stream: [ OK ] 35.58 sec. 2025-10-09 12:09:38 01753_mutate_table_predicated_with_table: [ OK ] 1.03 sec. 2025-10-09 12:09:38 03143_cte_scope: [ OK ] 0.88 sec. 2025-10-09 12:09:39 02227_union_match_by_name: [ OK ] 0.73 sec. 2025-10-09 12:09:39 03263_analyzer_materialized_view_cte_nested: [ OK ] 0.78 sec. 2025-10-09 12:09:39 02122_parallel_formatting_JSONStrings: [ OK ] 7.95 sec. 2025-10-09 12:09:39 02883_array_scalar_mult_div_modulo: [ OK ] 1.13 sec. 2025-10-09 12:09:39 00981_topK_topKWeighted_long: [ OK ] 10.05 sec. 2025-10-09 12:09:39 02317_functions_with_nothing: [ OK ] 0.68 sec. 2025-10-09 12:09:39 00262_alter_alias: [ OK ] 1.08 sec. 2025-10-09 12:09:39 03095_msan_uuid_string_to_num: [ OK ] 0.73 sec. 2025-10-09 12:09:39 00674_has_array_enum: [ OK ] 0.58 sec. 2025-10-09 12:09:41 02013_json_function_null_column: [ OK ] 1.18 sec. 2025-10-09 12:09:41 01622_defaults_for_url_engine: [ OK ] 2.34 sec. 2025-10-09 12:09:41 00647_select_numbers_with_offset: [ OK ] 0.73 sec. 2025-10-09 12:09:42 02352_grouby_shadows_arg: [ OK ] 0.73 sec. 2025-10-09 12:09:42 01839_join_to_subqueries_rewriter_columns_matcher: [ OK ] 0.73 sec. 2025-10-09 12:09:43 01013_hex_float: [ OK ] 0.78 sec. 2025-10-09 12:09:43 01659_test_base64Decode_mysql_compatibility: [ OK ] 0.78 sec. 2025-10-09 12:09:43 02374_analyzer_join_using: [ OK ] 3.64 sec. 2025-10-09 12:09:43 01657_test_toHour_mysql_compatibility: [ OK ] 0.58 sec. 2025-10-09 12:09:44 01083_cross_to_inner_with_in_bug: [ OK ] 0.73 sec. 2025-10-09 12:09:44 02831_trash: [ OK ] 0.68 sec. 2025-10-09 12:09:44 02377_optimize_sorting_by_input_stream_properties: [ OK ] 1.18 sec. 2025-10-09 12:09:44 02430_initialize_aggregation_with_combinators: [ OK ] 0.58 sec. 2025-10-09 12:09:44 00365_statistics_in_formats: [ OK ] 5.65 sec. 2025-10-09 12:09:45 03166_mv_prewhere_duplicating_name_bug: [ OK ] 0.83 sec. 2025-10-09 12:09:45 02479_nullable_primary_key_non_first_column: [ OK ] 0.78 sec. 2025-10-09 12:09:46 02293_grouping_function_group_by: [ OK ] 1.43 sec. 2025-10-09 12:09:46 00521_multidimensional: [ OK ] 1.18 sec. 2025-10-09 12:09:46 02494_analyzer_compound_expression_crash_fix: [ OK ] 0.68 sec. 2025-10-09 12:09:47 02990_format_select_from_explain: [ OK ] 1.88 sec. 2025-10-09 12:09:47 00742_require_join_strictness: [ OK ] 0.52 sec. 2025-10-09 12:09:47 02204_fractional_progress_bar_long: [ SKIPPED ] 0.00 sec. 2025-10-09 12:09:47 Reason: not running for current build 2025-10-09 12:09:48 01079_bad_alters_zookeeper_long: [ OK ] 12.31 sec. 2025-10-09 12:09:48 00181_aggregate_functions_statistics_stable: [ OK ] 1.48 sec. 2025-10-09 12:09:48 01010_pm_join_all_join_bug: [ OK ] 0.73 sec. 2025-10-09 12:09:49 03228_variant_permutation_issue: [ OK ] 0.93 sec. 2025-10-09 12:09:52 01825_type_json_13: [ OK ] 5.59 sec. 2025-10-09 12:09:52 02890_partition_prune_in_extra_columns: [ OK ] 0.78 sec. 2025-10-09 12:09:54 03034_ddls_and_merges_with_unusual_maps: [ OK ] 1.08 sec. 2025-10-09 12:09:54 02813_array_agg: [ OK ] 0.63 sec. 2025-10-09 12:09:54 03038_nested_dynamic_merges_compact_horizontal: [ SKIPPED ] 0.00 sec. 2025-10-09 12:09:54 Reason: not running for current build 2025-10-09 12:09:55 00763_create_query_as_table_engine_bug: [ OK ] 0.68 sec. 2025-10-09 12:09:56 02960_alter_table_part_query_parameter: [ OK ] 0.78 sec. 2025-10-09 12:09:56 01691_parser_data_type_exponential: [ OK ] 7.20 sec. 2025-10-09 12:09:57 01549_low_cardinality_mv_fuzz: [ OK ] 0.79 sec. 2025-10-09 12:09:58 01430_fix_any_rewrite_aliases: [ OK ] 0.94 sec. 2025-10-09 12:09:59 01576_alias_column_rewrite: [ OK ] 2.40 sec. 2025-10-09 12:09:59 01457_int256_hashing: [ OK ] 1.18 sec. 2025-10-09 12:10:00 00482_subqueries_and_aliases: [ OK ] 0.90 sec. 2025-10-09 12:10:00 02953_slow_create_view: [ OK ] 1.10 sec. 2025-10-09 12:10:01 02266_auto_add_nullable: [ OK ] 0.90 sec. 2025-10-09 12:10:03 02370_lost_part_intersecting_merges: [ OK ] 23.83 sec. 2025-10-09 12:10:03 02918_template_format_deadlock: [ OK ] 2.55 sec. 2025-10-09 12:10:04 02995_forget_partition: [ OK ] 15.95 sec. 2025-10-09 12:10:04 01774_case_sensitive_connection_id: [ OK ] 0.72 sec. 2025-10-09 12:10:05 01024__getScalar: [ OK ] 0.74 sec. 2025-10-09 12:10:05 01271_show_privileges: [ OK ] 0.73 sec. 2025-10-09 12:10:06 02250_lots_of_columns_in_csv_with_names: [ OK ] 5.76 sec. 2025-10-09 12:10:06 03167_base64_url_functions_sh: [ OK ] 100.58 sec. 2025-10-09 12:10:08 02800_transform_alter: [ OK ] 1.71 sec. 2025-10-09 12:10:09 01097_one_more_range_reader_test_wide_part: [ OK ] 0.98 sec. 2025-10-09 12:10:10 02026_arrayDifference_const: [ OK ] 0.68 sec. 2025-10-09 12:10:10 02131_used_row_policies_in_query_log: [ OK ] 4.42 sec. 2025-10-09 12:10:10 02972_insert_deduplication_token_hierarchical_inserts_views: [ OK ] 6.74 sec. 2025-10-09 12:10:10 01825_new_type_json_7: [ OK ] 6.06 sec. 2025-10-09 12:10:11 03305_fix_kafka_table_with_kw_arguments: [ OK ] 0.79 sec. 2025-10-09 12:10:11 02790_url_multiple_tsv_files: [ OK ] 5.83 sec. 2025-10-09 12:10:12 01055_compact_parts_1: [ OK ] 0.94 sec. 2025-10-09 12:10:12 01107_join_right_table_totals: [ OK ] 1.55 sec. 2025-10-09 12:10:12 01451_wrong_error_long_query: [ OK ] 2.24 sec. 2025-10-09 12:10:13 02692_multiple_joins_unicode: [ OK ] 1.08 sec. 2025-10-09 12:10:13 02969_archive_seek: [ OK ] 2.69 sec. 2025-10-09 12:10:13 02184_ipv6_cast_test: [ OK ] 0.89 sec. 2025-10-09 12:10:13 02473_extract_low_cardinality_from_json: [ OK ] 0.84 sec. 2025-10-09 12:10:14 03033_create_as_copies_comment: [ OK ] 0.83 sec. 2025-10-09 12:10:16 01276_random_string: [ OK ] 4.12 sec. 2025-10-09 12:10:17 01292_quantile_array_bug: [ OK ] 0.78 sec. 2025-10-09 12:10:17 03211_nested_json_merges: [ SKIPPED ] 0.00 sec. 2025-10-09 12:10:17 Reason: not running for current build 2025-10-09 12:10:18 01073_crlf_end_of_line: [ OK ] 0.93 sec. 2025-10-09 12:10:18 02770_jit_aggregation_nullable_key_fix: [ OK ] 3.36 sec. 2025-10-09 12:10:19 03313_case_insensitive_json_type_declaration: [ OK ] 0.74 sec. 2025-10-09 12:10:19 03198_unload_primary_key_outdated: [ OK ] 5.51 sec. 2025-10-09 12:10:19 01385_not_function: [ OK ] 0.78 sec. 2025-10-09 12:10:20 02366_kql_func_math: [ OK ] 1.01 sec. 2025-10-09 12:10:21 02129_window_functions_disable_optimizations: [ OK ] 1.09 sec. 2025-10-09 12:10:21 01440_big_int_shift: [ OK ] 0.79 sec. 2025-10-09 12:10:22 01544_errorCodeToName: [ OK ] 1.13 sec. 2025-10-09 12:10:23 00805_round_down: [ OK ] 2.09 sec. 2025-10-09 12:10:24 00875_join_right_nulls_ors: [ OK ] 2.31 sec. 2025-10-09 12:10:24 01098_msgpack_format: [ OK ] 39.72 sec. 2025-10-09 12:10:24 00075_shard_formatting_negate_of_negative_literal: [ OK ] 1.19 sec. 2025-10-09 12:10:27 00147_alter_nested_default: [ OK ] 2.48 sec. 2025-10-09 12:10:28 00811_garbage: [ OK ] 1.29 sec. 2025-10-09 12:10:29 01268_mv_scalars: [ OK ] 4.74 sec. 2025-10-09 12:10:30 03215_varian_as_common_type_tuple_map: [ OK ] 1.17 sec. 2025-10-09 12:10:30 02181_sql_user_defined_functions_invalid_lambda: [ OK ] 0.86 sec. 2025-10-09 12:10:31 00734_timeslot: [ OK ] 1.38 sec. 2025-10-09 12:10:32 01700_mod_negative_type_promotion: [ OK ] 1.00 sec. 2025-10-09 12:10:33 03023_remove_unused_column_distinct: [ OK ] 0.90 sec. 2025-10-09 12:10:33 02383_join_and_filtering_set: [ SKIPPED ] 0.00 sec. 2025-10-09 12:10:33 Reason: not running for current build 2025-10-09 12:10:33 01710_query_log_with_projection_info: [ OK ] 8.59 sec. 2025-10-09 12:10:33 00834_kill_mutation_replicated_zookeeper: [ OK ] 53.61 sec. 2025-10-09 12:10:33 01072_select_constant_limit: [ OK ] 0.74 sec. 2025-10-09 12:10:35 00165_transform_non_const_default: [ OK ] 1.45 sec. 2025-10-09 12:10:37 02718_parquet_metadata_format: [ OK ] 6.04 sec. 2025-10-09 12:10:37 02001_append_output_file: [ OK ] 3.61 sec. 2025-10-09 12:10:37 02293_ttest_large_samples: [ OK ] 19.51 sec. 2025-10-09 12:10:38 01093_cyclic_defaults_filimonov: [ OK ] 1.20 sec. 2025-10-09 12:10:38 02429_combinators_in_array_reduce: [ OK ] 1.23 sec. 2025-10-09 12:10:38 00024_unused_array_join_in_subquery: [ OK ] 1.00 sec. 2025-10-09 12:10:39 01655_window_functions_bug: [ OK ] 1.13 sec. 2025-10-09 12:10:39 02354_numeric_literals_with_underscores: [ OK ] 1.15 sec. 2025-10-09 12:10:41 02552_client_format_settings: [ OK ] 1.11 sec. 2025-10-09 12:10:41 03038_move_partition_to_oneself_deadlock: [ OK ] 1.45 sec. 2025-10-09 12:10:41 02366_kql_operator_in_sql: [ OK ] 2.69 sec. 2025-10-09 12:10:42 01100_split_by_string: [ OK ] 1.11 sec. 2025-10-09 12:10:42 02493_inconsistent_hex_and_binary_number: [ OK ] 7.43 sec. 2025-10-09 12:10:42 01082_bit_test_out_of_bound: [ OK ] 1.70 sec. 2025-10-09 12:10:44 02954_analyzer_fuzz_i57086: [ OK ] 1.15 sec. 2025-10-09 12:10:45 02184_storage_add_support_ttl: [ OK ] 2.26 sec. 2025-10-09 12:10:45 01525_select_with_offset_fetch_clause: [ OK ] 1.29 sec. 2025-10-09 12:10:46 03031_input_format_allow_errors_num_bad_escape_sequence: [ OK ] 0.89 sec. 2025-10-09 12:10:47 01954_clickhouse_benchmark_multiple_long: [ OK ] 34.08 sec. 2025-10-09 12:10:47 01646_rewrite_sum_if: [ OK ] 1.82 sec. 2025-10-09 12:10:47 03205_json_syntax: [ OK ] 1.75 sec. 2025-10-09 12:10:49 01825_type_json_2: [ OK ] 1.95 sec. 2025-10-09 12:10:49 02176_dict_get_has_implicit_key_cast: [ OK ] 2.35 sec. 2025-10-09 12:10:49 02027_ngrams: [ OK ] 1.79 sec. 2025-10-09 12:10:50 00975_recursive_materialized_view: [ OK ] 1.19 sec. 2025-10-09 12:10:51 03001_data_version_column: [ OK ] 1.25 sec. 2025-10-09 12:10:51 02999_scalar_subqueries_bug_1: [ OK ] 1.61 sec. 2025-10-09 12:10:51 01287_max_execution_speed: [ OK ] 8.44 sec. 2025-10-09 12:10:51 01655_plan_optimizations: [ OK ] 39.68 sec. 2025-10-09 12:10:52 01459_default_value_of_argument_type_nullptr_dereference: [ OK ] 0.74 sec. 2025-10-09 12:10:52 02313_cross_join_dup_col_names: [ OK ] 0.80 sec. 2025-10-09 12:10:53 01234_to_string_monotonic: [ OK ] 2.42 sec. 2025-10-09 12:10:53 01125_dict_ddl_cannot_add_column: [ OK ] 0.94 sec. 2025-10-09 12:10:54 03014_window_view_crash: [ OK ] 0.81 sec. 2025-10-09 12:10:54 01852_hints_enum_name: [ OK ] 2.88 sec. 2025-10-09 12:10:55 02861_filter_pushdown_const_bug: [ OK ] 1.74 sec. 2025-10-09 12:10:56 01076_json_each_row_array: [ OK ] 2.74 sec. 2025-10-09 12:10:57 01088_benchmark_query_id: [ OK ] 6.58 sec. 2025-10-09 12:10:59 00639_startsWith: [ OK ] 1.30 sec. 2025-10-09 12:11:00 00331_final_and_prewhere: [ OK ] 1.23 sec. 2025-10-09 12:11:01 01442_date_time_with_params: [ OK ] 4.73 sec. 2025-10-09 12:11:01 00098_g_union_all: [ OK ] 0.75 sec. 2025-10-09 12:11:01 02841_not_ready_set_bug: [ OK ] 9.25 sec. 2025-10-09 12:11:02 00508_materialized_view_to: [ OK ] 1.39 sec. 2025-10-09 12:11:03 01312_case_insensitive_regexp: [ OK ] 0.95 sec. 2025-10-09 12:11:06 02949_parallel_replicas_in_subquery: [ OK ] 5.37 sec. 2025-10-09 12:11:07 00649_quantile_tdigest_negative: [ OK ] 0.77 sec. 2025-10-09 12:11:08 00753_alter_attach: [ OK ] 12.04 sec. 2025-10-09 12:11:09 02538_analyzer_create_table_as_select: [ OK ] 1.35 sec. 2025-10-09 12:11:09 02998_http_redirects: [ OK ] 2.39 sec. 2025-10-09 12:11:10 00957_delta_diff_bug: [ OK ] 1.16 sec. 2025-10-09 12:11:10 03111_inner_join_group_by: [ OK ] 0.70 sec. 2025-10-09 12:11:11 00804_test_custom_compression_codes_log_storages: [ OK ] 7.43 sec. 2025-10-09 12:11:11 00600_create_temporary_table_if_not_exists: [ OK ] 0.70 sec. 2025-10-09 12:11:12 01766_todatetime64_no_timezone_arg: [ OK ] 0.76 sec. 2025-10-09 12:11:12 00411_long_accurate_number_comparison_int4: [ OK ] 30.78 sec. 2025-10-09 12:11:12 02494_optimize_group_by_function_keys_and_alias_columns: [ OK ] 1.65 sec. 2025-10-09 12:11:13 02146_mv_non_phys: [ OK ] 0.75 sec. 2025-10-09 12:11:13 02998_analyzer_secret_args_tree_node: [ OK ] 0.93 sec. 2025-10-09 12:11:14 01069_database_memory: [ OK ] 0.86 sec. 2025-10-09 12:11:15 02933_group_by_memory_usage: [ OK ] 21.54 sec. 2025-10-09 12:11:15 02861_join_on_nullsafe_compare: [ OK ] 4.35 sec. 2025-10-09 12:11:16 02786_parquet_big_integer_compatibility: [ OK ] 3.18 sec. 2025-10-09 12:11:16 02816_check_projection_metadata: [ OK ] 0.73 sec. 2025-10-09 12:11:17 01714_alter_drop_version: [ OK ] 0.84 sec. 2025-10-09 12:11:17 01413_if_array_uuid: [ OK ] 0.74 sec. 2025-10-09 12:11:19 01338_long_select_and_alter_zookeeper: [ OK ] 17.45 sec. 2025-10-09 12:11:20 02206_format_override: [ OK ] 4.26 sec. 2025-10-09 12:11:20 00714_alter_uuid: [ OK ] 1.49 sec. 2025-10-09 12:11:22 02769_compare_functions_nan: [ OK ] 1.92 sec. 2025-10-09 12:11:22 01943_query_id_check: [ OK ] 4.85 sec. 2025-10-09 12:11:22 03167_fancy_quotes_off_by_one: [ OK ] 0.64 sec. 2025-10-09 12:11:22 01404_roundUpToPowerOfTwoOrZero_safety: [ OK ] 0.79 sec. 2025-10-09 12:11:24 02764_csv_trim_whitespaces: [ OK ] 50.94 sec. 2025-10-09 12:11:24 00441_nulls_in: [ OK ] 1.38 sec. 2025-10-09 12:11:24 02876_yyyymmddhhmmsstodatetime: [ OK ] 3.45 sec. 2025-10-09 12:11:25 00917_multiple_joins_denny_crane: [ OK ] 1.10 sec. 2025-10-09 12:11:25 00311_array_primary_key: [ OK ] 1.33 sec. 2025-10-09 12:11:25 00997_trim: [ OK ] 3.00 sec. 2025-10-09 12:11:26 01441_array_combinator: [ OK ] 0.79 sec. 2025-10-09 12:11:27 03062_analyzer_join_engine_missing_column: [ OK ] 1.10 sec. 2025-10-09 12:11:27 02597_column_delete_and_replication: [ OK ] 2.69 sec. 2025-10-09 12:11:27 00389_concat_operator: [ OK ] 0.75 sec. 2025-10-09 12:11:27 01398_in_tuple_func: [ OK ] 1.05 sec. 2025-10-09 12:11:27 01507_transform_null_in: [ OK ] 0.89 sec. 2025-10-09 12:11:28 02267_type_inference_for_insert_into_function_null: [ OK ] 0.95 sec. 2025-10-09 12:11:28 01822_union_and_constans_error: [ OK ] 0.95 sec. 2025-10-09 12:11:29 03036_schema_inference_cache_s3_archives: [ OK ] 1.25 sec. 2025-10-09 12:11:32 02810_async_insert_dedup_replicated_collapsing: [ OK ] 17.67 sec. 2025-10-09 12:11:33 01496_signedness_conversion_monotonicity: [ OK ] 0.95 sec. 2025-10-09 12:11:37 00937_format_schema_rows_template: [ OK ] 8.29 sec. 2025-10-09 12:11:38 02668_parse_datetime_in_joda_syntax: [ OK ] 5.61 sec. 2025-10-09 12:11:39 03262_column_sizes_with_dynamic_structure: [ OK ] 10.71 sec. 2025-10-09 12:11:39 01548_create_table_compound_column_format: [ OK ] 2.57 sec. 2025-10-09 12:11:45 02972_insert_deduplication_token_hierarchical_inserts: [ OK ] 6.79 sec. 2025-10-09 12:11:46 02661_read_from_archive_tzst: [ OK ] 29.24 sec. 2025-10-09 12:11:46 01358_lc_parquet: [ OK ] 17.53 sec. 2025-10-09 12:11:47 01825_type_json_16: [ OK ] 7.53 sec. 2025-10-09 12:11:48 00578_merge_table_sampling: [ OK ] 1.29 sec. 2025-10-09 12:11:49 02915_fpc_overflow: [ OK ] 2.27 sec. 2025-10-09 12:11:49 03140_client_subsequent_external_tables: [ OK ] 2.86 sec. 2025-10-09 12:11:50 01514_empty_buffer_different_types: [ OK ] 1.09 sec. 2025-10-09 12:11:51 01663_test_toDate_mysql_compatibility: [ OK ] 0.80 sec. 2025-10-09 12:11:54 00700_decimal_complex_types: [ OK ] 5.80 sec. 2025-10-09 12:11:58 01059_storage_file_compression: [ OK ] 46.73 sec. 2025-10-09 12:11:59 01071_window_view_event_tumble_asc_join: [ OK ] 8.25 sec. 2025-10-09 12:12:00 02133_issue_32458: [ OK ] 1.10 sec. 2025-10-09 12:12:01 00688_low_cardinality_alter_add_column: [ OK ] 1.05 sec. 2025-10-09 12:12:01 02311_hashed_array_dictionary_hierarchical_functions: [ OK ] 1.81 sec. 2025-10-09 12:12:01 02151_http_s_structure_set_eof: [ OK ] 7.22 sec. 2025-10-09 12:12:02 02875_final_invalid_read_ranges_bug: [ OK ] 1.08 sec. 2025-10-09 12:12:03 01674_unicode_asan: [ OK ] 1.25 sec. 2025-10-09 12:12:03 02125_lz4_compression_bug_TSKV: [ OK ] 17.59 sec. 2025-10-09 12:12:03 02479_if_with_null_and_cullable_const: [ OK ] 0.78 sec. 2025-10-09 12:12:03 00513_fractional_time_zones: [ OK ] 0.79 sec. 2025-10-09 12:12:04 01655_agg_if_nullable: [ OK ] 0.91 sec. 2025-10-09 12:12:04 02251_last_day_of_month: [ OK ] 0.99 sec. 2025-10-09 12:12:05 00199_ternary_operator_type_check: [ OK ] 2.06 sec. 2025-10-09 12:12:05 02315_pmj_union_ubsan_35857: [ OK ] 0.93 sec. 2025-10-09 12:12:06 03352_distinct_sorted_bug: [ OK ] 0.84 sec. 2025-10-09 12:12:06 02835_fuzz_remove_redundant_sorting: [ OK ] 2.00 sec. 2025-10-09 12:12:07 02455_extract_fixed_string_from_nested_json: [ OK ] 1.05 sec. 2025-10-09 12:12:07 02916_distributed_skip_unavailable_shards: [ OK ] 1.04 sec. 2025-10-09 12:12:07 02724_function_in_left_table_clause_asof_join: [ OK ] 0.89 sec. 2025-10-09 12:12:08 00434_tonullable: [ OK ] 0.79 sec. 2025-10-09 12:12:08 00963_startsWith_force_primary_key: [ OK ] 0.89 sec. 2025-10-09 12:12:11 02205_postgresql_functions: [ OK ] 2.71 sec. 2025-10-09 12:12:15 01685_ssd_cache_dictionary_complex_key: [ OK ] 4.42 sec. 2025-10-09 12:12:16 01010_pmj_on_disk: [ OK ] 1.30 sec. 2025-10-09 12:12:18 01231_operator_null_in: [ OK ] 9.83 sec. 2025-10-09 12:12:20 02372_now_in_block: [ OK ] 1.57 sec. 2025-10-09 12:12:21 00534_functions_bad_arguments12: [ OK ] 31.55 sec. 2025-10-09 12:12:21 00608_uniq_array: [ OK ] 0.94 sec. 2025-10-09 12:12:21 02122_parallel_formatting_PrettyNoEscapes: [ OK ] 15.25 sec. 2025-10-09 12:12:22 00231_format_vertical_raw: [ OK ] 0.86 sec. 2025-10-09 12:12:22 01428_hash_set_nan_key: [ OK ] 1.08 sec. 2025-10-09 12:12:23 01267_alter_default_key_columns_zookeeper_long: [ OK ] 1.79 sec. 2025-10-09 12:12:23 02013_zlib_read_after_eof: [ OK ] 6.48 sec. 2025-10-09 12:12:24 02234_position_case_insensitive_utf8: [ OK ] 0.80 sec. 2025-10-09 12:12:25 02324_map_combinator_bug: [ OK ] 1.19 sec. 2025-10-09 12:12:25 02115_write_buffers_finalize: [ OK ] 24.29 sec. 2025-10-09 12:12:26 03305_compressed_memory_eng_crash_reading_subcolumn: [ OK ] 0.99 sec. 2025-10-09 12:12:26 02722_matcher_join_use_nulls: [ OK ] 3.52 sec. 2025-10-09 12:12:26 00725_join_on_bug_4: [ OK ] 0.99 sec. 2025-10-09 12:12:27 02893_bad_sample_view: [ OK ] 0.89 sec. 2025-10-09 12:12:27 01600_multiple_left_join_with_aliases: [ OK ] 0.88 sec. 2025-10-09 12:12:28 01050_group_array_sample: [ OK ] 0.85 sec. 2025-10-09 12:12:28 02869_http_headers_elapsed_ns: [ OK ] 2.16 sec. 2025-10-09 12:12:29 02971_functions_to_subcolumns_variant: [ OK ] 0.90 sec. 2025-10-09 12:12:29 02815_fix_not_found_constants_col_in_block: [ OK ] 1.01 sec. 2025-10-09 12:12:30 02941_variant_type_2: [ OK ] 50.65 sec. 2025-10-09 12:12:30 03203_system_numbers_limit_and_offset_complex: [ OK ] 1.22 sec. 2025-10-09 12:12:31 00820_multiple_joins_subquery_requires_alias: [ OK ] 1.63 sec. 2025-10-09 12:12:34 03001_bad_error_message_higher_order_functions: [ OK ] 3.06 sec. 2025-10-09 12:12:35 02290_client_insert_cancel: [ OK ] 4.32 sec. 2025-10-09 12:12:36 02122_parallel_formatting_Pretty: [ OK ] 13.80 sec. 2025-10-09 12:12:37 00900_long_parquet: [ OK ] 71.89 sec. 2025-10-09 12:12:37 01700_system_zookeeper_path_in: [ OK ] 1.24 sec. 2025-10-09 12:12:39 02771_ignore_data_skipping_indices: [ OK ] 1.94 sec. 2025-10-09 12:12:41 02122_parallel_formatting_Markdown: [ OK ] 7.00 sec. 2025-10-09 12:12:42 03001_block_offset_column_2: [ OK ] 1.04 sec. 2025-10-09 12:12:43 02174_cte_scalar_cache: [ OK ] 5.56 sec. 2025-10-09 12:12:43 00909_ngram_distance: [ OK ] 7.89 sec. 2025-10-09 12:12:43 00897_flatten: [ OK ] 0.99 sec. 2025-10-09 12:12:43 01658_values_ubsan: [ OK ] 0.83 sec. 2025-10-09 12:12:44 02163_operators: [ OK ] 0.73 sec. 2025-10-09 12:12:46 02315_readonly_create_function: [ OK ] 2.79 sec. 2025-10-09 12:12:47 02456_bloom_filter_assert: [ OK ] 1.85 sec. 2025-10-09 12:12:48 03200_memory_engine_alter_dynamic: [ OK ] 0.84 sec. 2025-10-09 12:12:52 03134_positional_arguments: [ OK ] 7.32 sec. 2025-10-09 12:12:52 02539_settings_alias: [ OK ] 8.65 sec. 2025-10-09 12:12:53 00502_sum_map: [ OK ] 1.69 sec. 2025-10-09 12:12:54 03198_orc_read_time_zone: [ OK ] 5.30 sec. 2025-10-09 12:12:55 02265_per_table_ttl_mutation_on_change: [ OK ] 1.44 sec. 2025-10-09 12:12:56 00534_functions_bad_arguments4_long: [ OK ] 25.72 sec. 2025-10-09 12:12:56 02457_morton_coding: [ OK ] 2.80 sec. 2025-10-09 12:12:57 00440_nulls_merge_tree: [ OK ] 0.90 sec. 2025-10-09 12:12:57 02243_make_date32_mysql: [ OK ] 1.49 sec. 2025-10-09 12:12:58 02536_date_from_number_inference_fix: [ OK ] 0.73 sec. 2025-10-09 12:12:58 00700_decimal_with_default_precision_and_scale: [ OK ] 0.84 sec. 2025-10-09 12:12:58 02998_primary_key_skip_columns: [ SKIPPED ] 0.00 sec. 2025-10-09 12:12:58 Reason: not running for current build 2025-10-09 12:12:59 02356_insert_query_log_metrics: [ OK ] 3.88 sec. 2025-10-09 12:13:00 02113_format_row: [ OK ] 0.86 sec. 2025-10-09 12:13:00 02489_analyzer_indexes: [ OK ] 1.80 sec. 2025-10-09 12:13:01 01044_h3_edge_angle: [ OK ] 0.69 sec. 2025-10-09 12:13:02 01825_new_type_json_8: [ OK ] 9.80 sec. 2025-10-09 12:13:02 02482_insert_into_dist_race: [ OK ] 1.45 sec. 2025-10-09 12:13:03 03172_http_content_encoding: [ OK ] 4.85 sec. 2025-10-09 12:13:03 02915_analyzer_fuzz_2: [ OK ] 1.39 sec. 2025-10-09 12:13:03 02969_analyzer_eliminate_injective_functions: [ OK ] 0.89 sec. 2025-10-09 12:13:04 00266_read_overflow_mode: [ OK ] 0.79 sec. 2025-10-09 12:13:04 03008_filter_projections_non_deterministoc_functions: [ OK ] 3.70 sec. 2025-10-09 12:13:04 00847_multiple_join_same_column: [ OK ] 1.29 sec. 2025-10-09 12:13:04 00981_no_virtual_columns: [ OK ] 0.79 sec. 2025-10-09 12:13:04 03039_dynamic_summing_merge_tree: [ OK ] 37.10 sec. 2025-10-09 12:13:05 02531_ipv4_arithmetic: [ OK ] 0.79 sec. 2025-10-09 12:13:05 00102_insert_into_temporary_table: [ OK ] 0.82 sec. 2025-10-09 12:13:07 02891_rename_table_without_keyword: [ OK ] 1.34 sec. 2025-10-09 12:13:07 02017_bit_shift_left_for_string_integer: [ OK ] 3.30 sec. 2025-10-09 12:13:09 02370_analyzer_in_function: [ OK ] 1.24 sec. 2025-10-09 12:13:09 02203_shebang: [ OK ] 2.39 sec. 2025-10-09 12:13:09 02888_obsolete_settings: [ OK ] 0.89 sec. 2025-10-09 12:13:10 03291_json_big_structure_deserialization: [ OK ] 31.02 sec. 2025-10-09 12:13:10 01892_setting_limit_offset_distributed: [ OK ] 1.09 sec. 2025-10-09 12:13:10 02916_set_formatting: [ OK ] 0.79 sec. 2025-10-09 12:13:11 01576_if_null_external_aggregation: [ OK ] 6.26 sec. 2025-10-09 12:13:11 01915_json_extract_raw_string: [ OK ] 0.83 sec. 2025-10-09 12:13:12 00688_low_cardinality_defaults: [ OK ] 0.84 sec. 2025-10-09 12:13:12 02907_backup_restore_flatten_nested: [ OK ] 7.18 sec. 2025-10-09 12:13:12 02734_sparse_columns_mutation: [ OK ] 1.78 sec. 2025-10-09 12:13:13 02476_query_parameters_without_serialisation: [ OK ] 1.11 sec. 2025-10-09 12:13:14 01818_move_partition_simple: [ OK ] 1.34 sec. 2025-10-09 12:13:15 02476_fix_lambda_parsing: [ OK ] 2.44 sec. 2025-10-09 12:13:17 02226_low_cardinality_text_bloom_filter_index: [ OK ] 1.94 sec. 2025-10-09 12:13:17 02221_parallel_replicas_bug: [ OK ] 6.61 sec. 2025-10-09 12:13:18 02994_sanity_check_settings: [ OK ] 0.88 sec. 2025-10-09 12:13:18 01070_string_to_h3: [ OK ] 0.73 sec. 2025-10-09 12:13:22 02535_json_bson_each_row_curl: [ OK ] 5.27 sec. 2025-10-09 12:13:26 03261_test_merge_parquet_bloom_filter_minmax_stats: [ OK ] 3.30 sec. 2025-10-09 12:13:26 02885_create_distributed_table_without_as: [ OK ] 0.84 sec. 2025-10-09 12:13:29 00515_enhanced_time_zones: [ OK ] 2.60 sec. 2025-10-09 12:13:30 02969_auto_format_detection: [ OK ] 19.84 sec. 2025-10-09 12:13:30 02160_h3_hex_area_Km2: [ OK ] 0.93 sec. 2025-10-09 12:13:32 02572_query_views_log_background_thread: [ OK ] 18.43 sec. 2025-10-09 12:13:35 02908_table_ttl_dependency: [ OK ] 4.38 sec. 2025-10-09 12:13:37 01521_alter_enum_and_reverse_read: [ OK ] 2.17 sec. 2025-10-09 12:13:37 02845_table_function_hdfs_filter_by_virtual_columns: [ OK ] 7.41 sec. 2025-10-09 12:13:38 02020_cast_integer_overflow: [ OK ] 0.94 sec. 2025-10-09 12:13:39 02834_timestamp_function: [ OK ] 1.41 sec. 2025-10-09 12:13:40 01273_arrow_arrays_load: [ OK ] 7.78 sec. 2025-10-09 12:13:40 00931_low_cardinality_read_with_empty_array: [ OK ] 1.29 sec. 2025-10-09 12:13:40 03215_varian_as_common_type_integers: [ OK ] 0.79 sec. 2025-10-09 12:13:41 00846_join_using_tuple_crash: [ OK ] 0.78 sec. 2025-10-09 12:13:41 02177_issue_31009: [ SKIPPED ] 0.00 sec. 2025-10-09 12:13:41 Reason: not running for current build 2025-10-09 12:13:41 02476_analyzer_identifier_hints: [ OK ] 37.30 sec. 2025-10-09 12:13:41 02790_async_queries_in_query_log: [ OK ] 22.79 sec. 2025-10-09 12:13:41 02565_update_empty_nested: [ OK ] 1.13 sec. 2025-10-09 12:13:42 02680_default_star: [ OK ] 0.73 sec. 2025-10-09 12:13:42 00488_column_name_primary: [ OK ] 0.94 sec. 2025-10-09 12:13:42 00938_test_retention_function: [ OK ] 1.29 sec. 2025-10-09 12:13:43 02921_bit_hamming_distance_big_int: [ OK ] 1.09 sec. 2025-10-09 12:13:43 02789_jit_cannot_convert_column: [ OK ] 0.85 sec. 2025-10-09 12:13:44 00080_show_tables_and_system_tables: [ OK ] 1.10 sec. 2025-10-09 12:13:44 00217_shard_global_subquery_columns_with_same_name: [ OK ] 1.12 sec. 2025-10-09 12:13:44 01648_mutations_and_escaping: [ OK ] 6.09 sec. 2025-10-09 12:13:45 01518_cast_nullable_virtual_system_column: [ OK ] 1.00 sec. 2025-10-09 12:13:45 03015_with_fill_invalid_expression: [ OK ] 0.84 sec. 2025-10-09 12:13:46 03237_get_subcolumn_low_cardinality_column: [ OK ] 0.86 sec. 2025-10-09 12:13:47 02871_clickhouse_client_restart_pager: [ OK ] 3.09 sec. 2025-10-09 12:13:48 02931_size_virtual_column_use_structure_from_insertion_table: [ OK ] 2.72 sec. 2025-10-09 12:13:48 02381_compress_marks_and_primary_key: [ OK ] 6.15 sec. 2025-10-09 12:13:50 00900_orc_arrays_load: [ OK ] 6.75 sec. 2025-10-09 12:13:50 00980_zookeeper_merge_tree_alter_settings: [ OK ] 2.39 sec. 2025-10-09 12:13:51 00695_pretty_max_column_pad_width: [ OK ] 0.63 sec. 2025-10-09 12:13:54 02931_file_cluster: [ OK ] 2.82 sec. 2025-10-09 12:13:54 03020_long_values_pretty_are_not_cut_if_single: [ OK ] 6.72 sec. 2025-10-09 12:13:54 00328_long_case_construction: [ OK ] 91.35 sec. 2025-10-09 12:13:55 03172_dynamic_binary_serialization: [ OK ] 40.83 sec. 2025-10-09 12:13:55 02224_parallel_distributed_insert_select_cluster: [ OK ] 1.30 sec. 2025-10-09 12:13:55 02384_analyzer_dict_get_join_get: [ OK ] 1.44 sec. 2025-10-09 12:13:55 03155_test_move_to_prewhere: [ OK ] 4.97 sec. 2025-10-09 12:13:55 03158_dynamic_type_from_variant: [ OK ] 0.97 sec. 2025-10-09 12:13:56 00154_shard_distributed_with_distinct: [ OK ] 0.84 sec. 2025-10-09 12:13:56 00837_minmax_index: [ OK ] 7.71 sec. 2025-10-09 12:13:57 01801_s3_cluster_count: [ OK ] 1.19 sec. 2025-10-09 12:13:57 00623_truncate_table: [ OK ] 2.19 sec. 2025-10-09 12:13:58 00161_rounding_functions: [ OK ] 2.24 sec. 2025-10-09 12:13:58 02377_modify_column_from_lc: [ OK ] 1.90 sec. 2025-10-09 12:13:58 02135_local_create_db: [ OK ] 2.64 sec. 2025-10-09 12:13:58 01188_attach_table_from_path: [ OK ] 1.08 sec. 2025-10-09 12:13:58 01621_summap_check_types: [ OK ] 0.83 sec. 2025-10-09 12:13:58 02713_ip4_uint_compare: [ OK ] 0.73 sec. 2025-10-09 12:13:59 01001_enums_in_in_section: [ OK ] 0.80 sec. 2025-10-09 12:13:59 01626_cnf_test: [ OK ] 1.10 sec. 2025-10-09 12:14:00 02030_function_mapContainsKeyLike: [ OK ] 1.55 sec. 2025-10-09 12:14:00 01302_polygons_distance: [ OK ] 1.15 sec. 2025-10-09 12:14:00 03150_grouping_sets_use_nulls_pushdown: [ OK ] 1.65 sec. 2025-10-09 12:14:00 03085_analyzer_alias_column_group_by: [ OK ] 0.79 sec. 2025-10-09 12:14:01 00603_system_parts_nonexistent_database: [ OK ] 0.79 sec. 2025-10-09 12:14:01 03093_bug_gcd_codec: [ OK ] 1.44 sec. 2025-10-09 12:14:02 00757_enum_defaults_const: [ OK ] 0.79 sec. 2025-10-09 12:14:02 02179_degrees_radians: [ OK ] 1.31 sec. 2025-10-09 12:14:02 03003_prql_panic: [ OK ] 2.71 sec. 2025-10-09 12:14:02 00392_enum_nested_alter: [ OK ] 2.31 sec. 2025-10-09 12:14:03 02475_or_function_alias_and_const_where: [ OK ] 0.74 sec. 2025-10-09 12:14:03 02394_every_profile_event_must_have_documentation: [ OK ] 0.85 sec. 2025-10-09 12:14:03 00338_replicate_array_of_strings: [ OK ] 0.89 sec. 2025-10-09 12:14:03 03015_optimize_final_rmt: [ SKIPPED ] 0.00 sec. 2025-10-09 12:14:03 Reason: not running for current build 2025-10-09 12:14:03 02515_tuple_lambda_parsing: [ OK ] 0.69 sec. 2025-10-09 12:14:03 01710_normal_projection_format: [ OK ] 0.63 sec. 2025-10-09 12:14:04 00800_low_cardinality_distributed_insert: [ OK ] 0.89 sec. 2025-10-09 12:14:04 00500_point_in_polygon: [ OK ] 2.09 sec. 2025-10-09 12:14:05 02785_left_anti_join_bug: [ OK ] 0.99 sec. 2025-10-09 12:14:05 01034_JSONCompactEachRow: [ OK ] 1.98 sec. 2025-10-09 12:14:06 03084_analyzer_join_column_alias: [ OK ] 0.93 sec. 2025-10-09 12:14:06 01099_operators_date_and_timestamp: [ OK ] 2.10 sec. 2025-10-09 12:14:06 00118_storage_join: [ OK ] 1.04 sec. 2025-10-09 12:14:07 00556_array_intersect: [ OK ] 0.88 sec. 2025-10-09 12:14:08 02517_uuid_parsing: [ OK ] 0.83 sec. 2025-10-09 12:14:08 02016_aggregation_spark_bar: [ OK ] 2.34 sec. 2025-10-09 12:14:09 02126_fix_filelog: [ OK ] 5.41 sec. 2025-10-09 12:14:09 01595_countMatches: [ OK ] 1.23 sec. 2025-10-09 12:14:09 01825_type_json_ghdata: [ OK ] 23.45 sec. 2025-10-09 12:14:10 03002_analyzer_prewhere: [ OK ] 0.94 sec. 2025-10-09 12:14:10 01470_test_insert_select_asterisk: [ OK ] 1.03 sec. 2025-10-09 12:14:11 02354_window_expression_with_aggregation_expression: [ OK ] 0.68 sec. 2025-10-09 12:14:11 02456_alter-nullable-column-bag-2: [ OK ] 1.18 sec. 2025-10-09 12:14:12 01736_null_as_default: [ OK ] 0.74 sec. 2025-10-09 12:14:12 02875_parallel_replicas_cluster_all_replicas: [ OK ] 2.64 sec. 2025-10-09 12:14:13 02833_local_with_dialect: [ OK ] 2.34 sec. 2025-10-09 12:14:14 00623_in_partition_key: [ OK ] 2.50 sec. 2025-10-09 12:14:14 01456_modify_column_type_via_add_drop_update: [ OK ] 2.70 sec. 2025-10-09 12:14:15 00113_shard_group_array: [ OK ] 19.85 sec. 2025-10-09 12:14:15 00292_parser_tuple_element: [ OK ] 0.74 sec. 2025-10-09 12:14:15 02355_column_type_name_lc: [ OK ] 0.79 sec. 2025-10-09 12:14:15 02229_client_stop_multiquery_in_SIGINT: [ OK ] 8.92 sec. 2025-10-09 12:14:15 01440_big_int_exotic_casts: [ OK ] 2.36 sec. 2025-10-09 12:14:16 01795_TinyLog_rwlock_ub: [ OK ] 0.90 sec. 2025-10-09 12:14:17 01480_binary_operator_monotonicity: [ OK ] 1.96 sec. 2025-10-09 12:14:18 02458_datediff_date32: [ OK ] 2.27 sec. 2025-10-09 12:14:19 01259_combinator_distinct: [ OK ] 1.20 sec. 2025-10-09 12:14:19 00849_multiple_comma_join_2: [ OK ] 3.74 sec. 2025-10-09 12:14:20 01042_check_query_and_last_granule_size: [ OK ] 2.21 sec. 2025-10-09 12:14:22 03093_reading_bug_with_parallel_replicas: [ OK ] 1.78 sec. 2025-10-09 12:14:22 01308_orc_output_format_arrays: [ OK ] 5.58 sec. 2025-10-09 12:14:22 00934_is_valid_utf8: [ OK ] 3.52 sec. 2025-10-09 12:14:23 02304_grouping_set_order_by: [ OK ] 0.68 sec. 2025-10-09 12:14:23 03210_nested_short_circuit_functions_bug: [ OK ] 0.88 sec. 2025-10-09 12:14:23 00527_totals_having_nullable: [ OK ] 0.88 sec. 2025-10-09 12:14:24 02688_long_aggregate_function_names: [ OK ] 0.85 sec. 2025-10-09 12:14:24 00215_primary_key_order_zookeeper_long: [ OK ] 1.44 sec. 2025-10-09 12:14:24 00779_all_right_join_max_block_size: [ OK ] 0.85 sec. 2025-10-09 12:14:25 01277_large_tuples: [ OK ] 0.84 sec. 2025-10-09 12:14:25 01825_type_json_in_other_types: [ OK ] 10.39 sec. 2025-10-09 12:14:25 01720_engine_file_empty_if_not_exists: [ OK ] 1.10 sec. 2025-10-09 12:14:26 01247_least_greatest_filimonov: [ OK ] 0.87 sec. 2025-10-09 12:14:27 00515_shard_desc_table_functions_and_subqueries: [ OK ] 2.00 sec. 2025-10-09 12:14:27 02115_map_contains_analyzer: [ OK ] 0.90 sec. 2025-10-09 12:14:29 01630_simple_aggregate_function_in_summing_merge_tree: [ OK ] 1.42 sec. 2025-10-09 12:14:30 01781_token_extractor_buffer_overflow: [ OK ] 4.51 sec. 2025-10-09 12:14:30 01087_index_set_ubsan: [ OK ] 0.91 sec. 2025-10-09 12:14:31 00950_bad_alloc_when_truncate_join_storage: [ OK ] 0.85 sec. 2025-10-09 12:14:32 01281_sum_nullable: [ OK ] 1.40 sec. 2025-10-09 12:14:33 00612_pk_in_tuple_perf: [ OK ] 8.86 sec. 2025-10-09 12:14:34 00218_like_regexp_newline: [ OK ] 1.05 sec. 2025-10-09 12:14:34 02971_limit_by_distributed: [ OK ] 1.38 sec. 2025-10-09 12:14:35 00968_roundAge: [ OK ] 0.78 sec. 2025-10-09 12:14:35 02792_drop_projection_lwd: [ OK ] 0.98 sec. 2025-10-09 12:14:36 01081_window_view_target_table_engine: [ OK ] 6.83 sec. 2025-10-09 12:14:37 02877_optimize_read_in_order_from_view: [ OK ] 10.21 sec. 2025-10-09 12:14:38 01787_map_remote: [ OK ] 1.13 sec. 2025-10-09 12:14:38 03237_max_map_state_decimal_serialization: [ OK ] 0.68 sec. 2025-10-09 12:14:38 01339_client_unrecognized_option: [ OK ] 3.10 sec. 2025-10-09 12:14:38 01171_mv_select_insert_isolation_long: [ OK ] 289.66 sec. 2025-10-09 12:14:39 02920_rename_column_of_skip_indices: [ OK ] 0.93 sec. 2025-10-09 12:14:39 02124_insert_deduplication_token: [ OK ] 1.24 sec. 2025-10-09 12:14:39 01825_type_json_mutations: [ OK ] 1.13 sec. 2025-10-09 12:14:40 01268_mergine_sorted_limit: [ OK ] 0.73 sec. 2025-10-09 12:14:40 02907_preferred_optimize_projection_name: [ OK ] 20.63 sec. 2025-10-09 12:14:40 02515_aggregate_functions_statistics: [ OK ] 1.53 sec. 2025-10-09 12:14:40 00910_buffer_prewhere: [ OK ] 0.73 sec. 2025-10-09 12:14:41 02982_comments_in_system_tables: [ OK ] 2.99 sec. 2025-10-09 12:14:41 03199_merge_filters_bug: [ OK ] 0.98 sec. 2025-10-09 12:14:41 01058_zlib_ng_level1_bug: [ OK ] 6.26 sec. 2025-10-09 12:14:41 03024_total_rows_approx_is_set_for_system_zeros_and_generate_random: [ OK ] 0.84 sec. 2025-10-09 12:14:42 00936_function_result_with_operator_in: [ OK ] 1.13 sec. 2025-10-09 12:14:42 02493_do_not_assume_that_the_original_query_was_valid_when_transforming_joins: [ OK ] 0.73 sec. 2025-10-09 12:14:42 03003_functions_to_subcolumns_final: [ OK ] 0.99 sec. 2025-10-09 12:14:42 01925_merge_prewhere_table: [ OK ] 0.78 sec. 2025-10-09 12:14:43 01075_allowed_client_hosts: [ OK ] 0.83 sec. 2025-10-09 12:14:43 02559_multiple_read_steps_in_prewhere_missing_columns_2: [ OK ] 0.98 sec. 2025-10-09 12:14:44 00753_comment_columns_zookeeper: [ OK ] 0.73 sec. 2025-10-09 12:14:44 02941_projections_external_aggregation: [ OK ] 3.14 sec. 2025-10-09 12:14:44 02242_make_date_mysql: [ OK ] 1.13 sec. 2025-10-09 12:14:45 03171_hashed_dictionary_short_circuit_bug_fix: [ OK ] 0.78 sec. 2025-10-09 12:14:45 01518_filtering_aliased_materialized_column: [ OK ] 0.73 sec. 2025-10-09 12:14:45 01825_new_type_json_nbagames: [ OK ] 44.67 sec. 2025-10-09 12:14:46 02382_join_and_filtering_set: [ OK ] 1.28 sec. 2025-10-09 12:14:46 01532_tuple_with_name_type: [ OK ] 0.83 sec. 2025-10-09 12:14:46 03164_early_constant_folding_analyzer: [ OK ] 0.83 sec. 2025-10-09 12:14:46 01014_format_custom_separated: [ OK ] 7.26 sec. 2025-10-09 12:14:46 00517_date_parsing: [ OK ] 1.13 sec. 2025-10-09 12:14:47 00400_client_external_options: [ OK ] 4.95 sec. 2025-10-09 12:14:47 02436_system_zookeeper_context: [ OK ] 0.78 sec. 2025-10-09 12:14:47 03164_linestring_geometry: [ OK ] 0.78 sec. 2025-10-09 12:14:47 02161_addressToLineWithInlines: [ SKIPPED ] 0.00 sec. 2025-10-09 12:14:47 Reason: not running for current build 2025-10-09 12:14:47 00098_shard_i_union_all: [ OK ] 1.03 sec. 2025-10-09 12:14:48 02212_h3_get_pentagon_indexes: [ OK ] 1.03 sec. 2025-10-09 12:14:48 01472_toBoundsOfInterval_disallow_empty_tz_field: [ OK ] 1.73 sec. 2025-10-09 12:14:48 01300_wkt: [ OK ] 1.13 sec. 2025-10-09 12:14:48 03142_skip_ANSI_in_UTF8_compute_width: [ OK ] 0.58 sec. 2025-10-09 12:14:49 02121_pager: [ OK ] 2.79 sec. 2025-10-09 12:14:49 01453_normalize_query_alias_uuid: [ OK ] 0.63 sec. 2025-10-09 12:14:49 00053_all_inner_join: [ OK ] 0.68 sec. 2025-10-09 12:14:50 02680_datetime64_monotonic_check: [ OK ] 1.03 sec. 2025-10-09 12:14:50 02477_analyzer_array_join_with_join: [ OK ] 2.49 sec. 2025-10-09 12:14:50 01657_array_element_ubsan: [ OK ] 0.93 sec. 2025-10-09 12:14:50 01431_utf8_ubsan: [ OK ] 0.63 sec. 2025-10-09 12:14:51 02006_use_constants_in_with_and_select: [ OK ] 0.83 sec. 2025-10-09 12:14:51 03154_recursive_cte_distributed: [ OK ] 1.59 sec. 2025-10-09 12:14:51 02843_date_predicate_optimizations_bugs: [ OK ] 0.73 sec. 2025-10-09 12:14:51 03034_normalized_ast: [ OK ] 0.73 sec. 2025-10-09 12:14:53 01083_aggregation_memory_efficient_bug: [ OK ] 1.64 sec. 2025-10-09 12:14:53 02897_alter_partition_parameters: [ OK ] 2.19 sec. 2025-10-09 12:14:54 02499_escaped_quote_schema_inference: [ OK ] 0.93 sec. 2025-10-09 12:14:54 02900_buffer_table_alter_race: [ OK ] 13.17 sec. 2025-10-09 12:14:54 02688_aggregate_states: [ OK ] 1.68 sec. 2025-10-09 12:14:58 02731_parallel_replicas_join_subquery: [ OK ] 9.32 sec. 2025-10-09 12:14:58 02416_keeper_map: [ OK ] 4.10 sec. 2025-10-09 12:15:04 01641_memory_tracking_insert_optimize: [ OK ] 6.28 sec. 2025-10-09 12:15:04 01502_jemalloc_percpu_arena: [ SKIPPED ] 0.00 sec. 2025-10-09 12:15:04 Reason: not running for current build 2025-10-09 12:15:05 00590_limit_by_column_removal: [ OK ] 0.79 sec. 2025-10-09 12:15:05 03037_dynamic_merges_2_horizontal_wide_merge_tree: [ SKIPPED ] 0.00 sec. 2025-10-09 12:15:05 Reason: not running for current build 2025-10-09 12:15:06 01817_storage_buffer_parameters: [ OK ] 0.94 sec. 2025-10-09 12:15:06 01214_point_in_Mecca: [ OK ] 7.62 sec. 2025-10-09 12:15:07 02693_multiple_joins_in: [ OK ] 0.83 sec. 2025-10-09 12:15:07 01825_new_type_json_multiple_files: [ OK ] 12.89 sec. 2025-10-09 12:15:08 01074_h3_range_check: [ OK ] 0.99 sec. 2025-10-09 12:15:09 03151_external_cross_join: [ OK ] 14.84 sec. 2025-10-09 12:15:10 02552_analyzer_optimize_group_by_function_keys_crash: [ OK ] 0.74 sec. 2025-10-09 12:15:13 01720_join_implicit_cast: [ OK ] 5.00 sec. 2025-10-09 12:15:14 02751_multiquery_with_argument: [ OK ] 7.76 sec. 2025-10-09 12:15:15 01497_alias_on_default_array: [ OK ] 1.08 sec. 2025-10-09 12:15:15 00672_arrayDistinct: [ OK ] 1.03 sec. 2025-10-09 12:15:15 01558_ttest_scipy: [ OK ] 4.80 sec. 2025-10-09 12:15:16 02902_add_scalar_in_all_case: [ OK ] 1.03 sec. 2025-10-09 12:15:16 02522_different_types_in_storage_merge: [ OK ] 1.08 sec. 2025-10-09 12:15:16 00296_url_parameters: [ OK ] 1.30 sec. 2025-10-09 12:15:16 02428_parameterized_view: [ OK ] 68.01 sec. 2025-10-09 12:15:17 02454_compressed_marks_in_compact_part: [ OK ] 0.78 sec. 2025-10-09 12:15:17 01390_remove_injective_in_uniq: [ OK ] 1.03 sec. 2025-10-09 12:15:17 02833_sparse_columns_tuple_function: [ OK ] 0.73 sec. 2025-10-09 12:15:18 01308_row_policy_and_trivial_count_query: [ OK ] 1.13 sec. 2025-10-09 12:15:19 03164_parallel_replicas_range_filter_min_max: [ OK ] 2.34 sec. 2025-10-09 12:15:19 01417_update_permutation_crash: [ OK ] 0.78 sec. 2025-10-09 12:15:19 02342_window_view_different_struct: [ OK ] 1.88 sec. 2025-10-09 12:15:20 03087_analyzer_subquery_with_alias: [ OK ] 0.73 sec. 2025-10-09 12:15:20 00034_fixed_string_to_number: [ OK ] 0.73 sec. 2025-10-09 12:15:20 03215_multilinestring_geometry: [ OK ] 1.18 sec. 2025-10-09 12:15:21 00916_join_using_duplicate_columns: [ OK ] 1.43 sec. 2025-10-09 12:15:21 02456_test_zero_copy_mutation: [ OK ] 1.43 sec. 2025-10-09 12:15:22 00205_emptyscalar_subquery_type_mismatch_bug: [ OK ] 0.88 sec. 2025-10-09 12:15:22 02490_replacing_merge_tree_is_deleted_column: [ OK ] 5.40 sec. 2025-10-09 12:15:23 01414_freeze_does_not_prevent_alters: [ OK ] 1.33 sec. 2025-10-09 12:15:24 00653_verification_monotonic_data_load: [ OK ] 32.81 sec. 2025-10-09 12:15:24 01780_column_sparse_pk: [ OK ] 1.59 sec. 2025-10-09 12:15:24 02896_cyclic_aliases_crash: [ OK ] 1.34 sec. 2025-10-09 12:15:24 02813_func_today_and_alias: [ OK ] 0.88 sec. 2025-10-09 12:15:25 02148_cast_type_parsing: [ OK ] 0.78 sec. 2025-10-09 12:15:25 03243_create_or_replace_view_dependency_check: [ OK ] 1.04 sec. 2025-10-09 12:15:26 00914_replicate: [ OK ] 0.69 sec. 2025-10-09 12:15:26 00835_if_generic_case: [ OK ] 1.25 sec. 2025-10-09 12:15:26 03203_fill_missed_subcolumns: [ OK ] 1.59 sec. 2025-10-09 12:15:27 02720_row_policy_column_with_dots: [ OK ] 1.04 sec. 2025-10-09 12:15:27 02160_special_functions: [ OK ] 1.54 sec. 2025-10-09 12:15:28 01043_h3_edge_length_m: [ OK ] 0.79 sec. 2025-10-09 12:15:29 02876_s3_cluster_schema_inference_names_with_spaces: [ OK ] 1.04 sec. 2025-10-09 12:15:29 00818_alias_bug_4110: [ OK ] 1.38 sec. 2025-10-09 12:15:29 01399_http_request_headers: [ OK ] 2.49 sec. 2025-10-09 12:15:32 02316_hierarchical_dictionaries_nullable_parent_key: [ OK ] 3.29 sec. 2025-10-09 12:15:33 00594_alias_in_distributed: [ OK ] 3.60 sec. 2025-10-09 12:15:33 01825_type_json_empty_string: [ OK ] 0.78 sec. 2025-10-09 12:15:34 02915_lazy_loading_of_base_backups: [ OK ] 11.43 sec. 2025-10-09 12:15:34 02474_timeDiff_UTCTimestamp: [ OK ] 0.99 sec. 2025-10-09 12:15:35 00535_parse_float_scientific: [ OK ] 0.88 sec. 2025-10-09 12:15:36 00688_low_cardinality_in: [ OK ] 1.28 sec. 2025-10-09 12:15:36 02907_clickhouse_dictionary_bug: [ OK ] 2.74 sec. 2025-10-09 12:15:37 01460_mark_inclusion_search_crash: [ OK ] 0.73 sec. 2025-10-09 12:15:38 00185_array_literals: [ OK ] 1.33 sec. 2025-10-09 12:15:39 01913_names_of_tuple_literal: [ OK ] 0.68 sec. 2025-10-09 12:15:40 02807_lower_utf8_msan: [ OK ] 0.78 sec. 2025-10-09 12:15:40 01675_distributed_bytes_to_delay_insert: [ OK ] 7.35 sec. 2025-10-09 12:15:41 02100_multiple_hosts_command_line_set_ssl: [ OK ] 34.73 sec. 2025-10-09 12:15:42 00967_insert_into_distributed_different_types: [ OK ] 1.19 sec. 2025-10-09 12:15:42 01085_simdjson_uint64: [ OK ] 0.69 sec. 2025-10-09 12:15:43 02949_parallel_replicas_scalar_subquery_big_integer: [ OK ] 1.06 sec. 2025-10-09 12:15:45 01384_bloom_filter_bad_arguments: [ OK ] 1.24 sec. 2025-10-09 12:15:46 01871_merge_tree_compile_expressions: [ OK ] 6.05 sec. 2025-10-09 12:15:47 00084_summing_merge_tree: [ OK ] 2.04 sec. 2025-10-09 12:15:48 01009_global_array_join_names: [ OK ] 1.48 sec. 2025-10-09 12:15:48 01505_trivial_count_with_partition_predicate: [ OK ] 2.53 sec. 2025-10-09 12:15:49 02477_exists_fuzz_43478: [ OK ] 0.89 sec. 2025-10-09 12:15:49 02494_zero_copy_and_projection_and_mutation_work_together: [ OK ] 7.75 sec. 2025-10-09 12:15:50 01601_proxy_protocol: [ OK ] 1.99 sec. 2025-10-09 12:15:52 03221_mutate_profile_events: [ OK ] 2.84 sec. 2025-10-09 12:15:52 01903_correct_block_size_prediction_with_default: [ OK ] 61.44 sec. 2025-10-09 12:15:53 02479_mysql_connect_to_self: [ OK ] 3.31 sec. 2025-10-09 12:15:53 00596_limit_on_expanded_ast: [ OK ] 2.45 sec. 2025-10-09 12:15:53 02354_vector_search_detach_attach: [ OK ] 0.84 sec. 2025-10-09 12:15:53 02874_array_random_sample: [ OK ] 17.05 sec. 2025-10-09 12:15:53 02024_compile_expressions_with_short_circuit_evaluation: [ OK ] 0.84 sec. 2025-10-09 12:15:53 01558_enum_as_num_in_tsv_csv_input: [ OK ] 1.04 sec. 2025-10-09 12:15:54 00037_totals_limit: [ OK ] 0.74 sec. 2025-10-09 12:15:54 01670_test_repeat_mysql_dialect: [ OK ] 0.69 sec. 2025-10-09 12:15:55 02575_merge_prewhere_materialized: [ OK ] 1.40 sec. 2025-10-09 12:15:55 02002_sampling_and_unknown_column_bug: [ OK ] 1.29 sec. 2025-10-09 12:15:55 01602_modified_julian_day_msan: [ OK ] 1.09 sec. 2025-10-09 12:15:55 02661_read_from_archive_targz: [ OK ] 26.64 sec. 2025-10-09 12:15:56 02119_sumcount: [ OK ] 2.50 sec. 2025-10-09 12:15:56 03033_tupleIntXYZ_and_tupleModulo: [ OK ] 1.45 sec. 2025-10-09 12:15:56 00348_tuples: [ OK ] 1.59 sec. 2025-10-09 12:15:57 02345_filesystem_local: [ OK ] 2.14 sec. 2025-10-09 12:15:57 03246_skipping_index_70108: [ OK ] 2.69 sec. 2025-10-09 12:15:57 00125_array_element_of_array_of_tuple: [ OK ] 0.68 sec. 2025-10-09 12:15:57 01849_geoToS2: [ OK ] 1.74 sec. 2025-10-09 12:15:58 01621_bar_nan_arguments: [ OK ] 0.78 sec. 2025-10-09 12:15:58 02366_window_function_order_by: [ OK ] 0.68 sec. 2025-10-09 12:15:58 00059_shard_global_in_mergetree: [ OK ] 1.74 sec. 2025-10-09 12:15:58 02871_join_on_system_errors: [ OK ] 0.73 sec. 2025-10-09 12:15:58 01710_projection_with_mixed_pipeline: [ OK ] 0.88 sec. 2025-10-09 12:15:58 01891_not_like_partition_prune: [ OK ] 0.79 sec. 2025-10-09 12:15:59 02675_predicate_push_down_filled_join_fix: [ OK ] 0.94 sec. 2025-10-09 12:15:59 02962_join_using_bug_57894: [ OK ] 0.94 sec. 2025-10-09 12:15:59 02482_execute_functions_before_sorting_bug: [ OK ] 0.83 sec. 2025-10-09 12:15:59 00251_has_types: [ OK ] 1.04 sec. 2025-10-09 12:16:00 02136_scalar_read_rows_json: [ OK ] 3.30 sec. 2025-10-09 12:16:00 02097_polygon_dictionary_store_key: [ OK ] 1.19 sec. 2025-10-09 12:16:00 00273_quantiles: [ OK ] 1.39 sec. 2025-10-09 12:16:01 00045_sorting_by_fixed_string_descending: [ OK ] 0.63 sec. 2025-10-09 12:16:01 02409_url_format_detection: [ OK ] 0.74 sec. 2025-10-09 12:16:05 00737_decimal_group_by: [ OK ] 3.87 sec. 2025-10-09 12:16:07 01451_detach_drop_part: [ OK ] 5.98 sec. 2025-10-09 12:16:08 01351_geohash_assert: [ OK ] 1.47 sec. 2025-10-09 12:16:09 01834_alias_columns_laziness_filimonov: [ OK ] 9.10 sec. 2025-10-09 12:16:11 03289_explain_syntax_statistics: [ OK ] 1.46 sec. 2025-10-09 12:16:12 00558_aggregate_merge_totals_with_arenas: [ OK ] 3.36 sec. 2025-10-09 12:16:16 02883_zookeeper_finalize_stress: [ OK ] 17.31 sec. 2025-10-09 12:16:17 02912_group_array_sample: [ OK ] 0.76 sec. 2025-10-09 12:16:18 01380_nullable_state: [ OK ] 5.74 sec. 2025-10-09 12:16:19 02353_partition_prune_nullable_key: [ OK ] 0.79 sec. 2025-10-09 12:16:19 03006_join_on_inequal_expression_2: [ OK ] 19.84 sec. 2025-10-09 12:16:19 01576_alter_low_cardinality_and_select: [ OK ] 14.37 sec. 2025-10-09 12:16:20 00059_shard_global_in: [ OK ] 0.94 sec. 2025-10-09 12:16:20 03156_group_concat: [ OK ] 2.85 sec. 2025-10-09 12:16:20 01881_create_as_tuple: [ OK ] 1.04 sec. 2025-10-09 12:16:21 01782_field_oom: [ OK ] 94.24 sec. 2025-10-09 12:16:21 01019_array_fill: [ OK ] 0.99 sec. 2025-10-09 12:16:21 02337_join_analyze_stuck: [ OK ] 2.59 sec. 2025-10-09 12:16:22 00821_distributed_storage_with_join_on: [ OK ] 1.49 sec. 2025-10-09 12:16:23 00626_replace_partition_from_table: [ OK ] 3.50 sec. 2025-10-09 12:16:24 00665_alter_nullable_string_to_nullable_uint8: [ OK ] 1.14 sec. 2025-10-09 12:16:24 01942_untuple_transformers_msan: [ OK ] 0.69 sec. 2025-10-09 12:16:25 02904_empty_order_by_with_setting_enabled: [ OK ] 4.20 sec. 2025-10-09 12:16:25 01593_insert_settings: [ OK ] 1.29 sec. 2025-10-09 12:16:25 03094_one_thousand_joins: [ OK ] 64.72 sec. 2025-10-09 12:16:25 02555_davengers_rename_chain: [ OK ] 13.38 sec. 2025-10-09 12:16:25 02381_client_prints_server_side_time: [ SKIPPED ] 0.00 sec. 2025-10-09 12:16:25 Reason: not running for current build 2025-10-09 12:16:25 02815_join_algorithm_setting: [ OK ] 3.75 sec. 2025-10-09 12:16:25 02999_ulid_short_circuit: [ OK ] 0.74 sec. 2025-10-09 12:16:25 00188_constants_as_arguments_of_aggregate_functions: [ OK ] 0.64 sec. 2025-10-09 12:16:26 02713_sequence_match_serialization_fix: [ OK ] 1.04 sec. 2025-10-09 12:16:26 02541_empty_function_support_ip: [ OK ] 0.79 sec. 2025-10-09 12:16:26 03060_analyzer_regular_view_alias: [ OK ] 0.79 sec. 2025-10-09 12:16:26 03169_modify_column_data_loss: [ OK ] 1.19 sec. 2025-10-09 12:16:27 01418_index_analysis_bug: [ OK ] 1.45 sec. 2025-10-09 12:16:27 03217_datetime64_constant_to_ast: [ OK ] 0.64 sec. 2025-10-09 12:16:27 02733_sparse_columns_reload: [ OK ] 0.99 sec. 2025-10-09 12:16:28 00192_least_greatest: [ OK ] 1.09 sec. 2025-10-09 12:16:28 02422_insert_different_granularity: [ OK ] 2.80 sec. 2025-10-09 12:16:28 01710_projections_optimize_aggregation_in_order: [ OK ] 29.36 sec. 2025-10-09 12:16:28 02752_space_function: [ OK ] 2.10 sec. 2025-10-09 12:16:28 01076_range_reader_segfault: [ OK ] 1.09 sec. 2025-10-09 12:16:29 03063_analyzer_multi_join_wrong_table_specifier: [ OK ] 0.89 sec. 2025-10-09 12:16:29 00554_nested_and_table_engines: [ OK ] 1.94 sec. 2025-10-09 12:16:29 01921_with_fill_with_totals: [ OK ] 0.84 sec. 2025-10-09 12:16:30 02189_join_type_conversion: [ OK ] 0.80 sec. 2025-10-09 12:16:30 01881_to_week_monotonic_fix: [ OK ] 1.15 sec. 2025-10-09 12:16:30 00973_uniq_non_associativity: [ OK ] 4.65 sec. 2025-10-09 12:16:31 02165_h3_num_hexagons: [ OK ] 1.09 sec. 2025-10-09 12:16:32 03165_string_functions_with_token_text_indexes: [ OK ] 3.90 sec. 2025-10-09 12:16:32 00842_array_with_constant_overflow: [ OK ] 0.68 sec. 2025-10-09 12:16:33 00999_join_not_nullable_types: [ OK ] 0.84 sec. 2025-10-09 12:16:33 02096_bad_options_in_client_and_local: [ OK ] 4.31 sec. 2025-10-09 12:16:33 02862_sorted_distinct_sparse_fix: [ OK ] 0.99 sec. 2025-10-09 12:16:34 02016_agg_empty_result_bug_28880: [ OK ] 1.03 sec. 2025-10-09 12:16:34 02680_illegal_type_of_filter_projection: [ OK ] 0.89 sec. 2025-10-09 12:16:34 01273_arrow_nested_arrays_load: [ OK ] 6.11 sec. 2025-10-09 12:16:35 00725_join_on_bug_1: [ OK ] 0.89 sec. 2025-10-09 12:16:35 01781_merge_tree_deduplication: [ OK ] 4.41 sec. 2025-10-09 12:16:35 02245_s3_schema_desc: [ OK ] 1.18 sec. 2025-10-09 12:16:35 02495_concat_with_separator: [ OK ] 2.69 sec. 2025-10-09 12:16:36 00844_join_lightee2: [ OK ] 0.99 sec. 2025-10-09 12:16:36 01586_columns_pruning: [ OK ] 1.34 sec. 2025-10-09 12:16:37 02534_join_prewhere_bug: [ OK ] 1.54 sec. 2025-10-09 12:16:37 01013_totals_without_aggregation: [ OK ] 0.80 sec. 2025-10-09 12:16:38 02784_projections_read_in_order_bug: [ OK ] 1.25 sec. 2025-10-09 12:16:38 00141_parse_timestamp_as_datetime: [ OK ] 0.73 sec. 2025-10-09 12:16:38 03169_time_virtual_column: [ OK ] 3.20 sec. 2025-10-09 12:16:39 01276_system_licenses: [ OK ] 1.09 sec. 2025-10-09 12:16:39 01710_projections_partial_optimize_aggregation_in_order: [ OK ] 17.41 sec. 2025-10-09 12:16:39 01086_window_view_cleanup: [ OK ] 10.72 sec. 2025-10-09 12:16:40 00834_not_between: [ OK ] 0.69 sec. 2025-10-09 12:16:41 02863_ignore_foreign_keys_in_tables_definition: [ OK ] 1.10 sec. 2025-10-09 12:16:41 00416_pocopatch_progress_in_http_headers: [ OK ] 2.45 sec. 2025-10-09 12:16:42 02842_mutations_replace_non_deterministic: [ OK ] 4.85 sec. 2025-10-09 12:16:42 01550_create_map_type: [ OK ] 4.25 sec. 2025-10-09 12:16:42 01492_format_readable_quantity: [ OK ] 0.69 sec. 2025-10-09 12:16:43 02523_range_const_start: [ OK ] 0.74 sec. 2025-10-09 12:16:43 03035_dynamic_sorting: [ OK ] 1.79 sec. 2025-10-09 12:16:44 01521_format_readable_time_delta2: [ OK ] 1.55 sec. 2025-10-09 12:16:44 01493_table_function_null: [ OK ] 0.75 sec. 2025-10-09 12:16:44 03221_merge_profile_events: [ OK ] 6.35 sec. 2025-10-09 12:16:45 03129_cte_with_final: [ OK ] 0.93 sec. 2025-10-09 12:16:45 00700_decimal_in_keys: [ OK ] 1.40 sec. 2025-10-09 12:16:45 02985_if_over_big_int_decimal: [ OK ] 1.04 sec. 2025-10-09 12:16:45 03144_invalid_filter: [ OK ] 0.78 sec. 2025-10-09 12:16:46 01614_with_fill_with_limit: [ OK ] 0.83 sec. 2025-10-09 12:16:46 02526_kv_engine_different_filter_type: [ OK ] 1.23 sec. 2025-10-09 12:16:46 03240_insert_select_named_tuple: [ OK ] 1.29 sec. 2025-10-09 12:16:47 02681_comparsion_tuple_elimination_ast: [ OK ] 0.74 sec. 2025-10-09 12:16:47 03165_parseReadableSize: [ OK ] 2.29 sec. 2025-10-09 12:16:47 01710_minmax_count_projection_distributed_query: [ OK ] 0.88 sec. 2025-10-09 12:16:48 00502_string_concat_with_array: [ OK ] 0.58 sec. 2025-10-09 12:16:48 02810_fix_remove_dedundant_distinct_view: [ OK ] 1.03 sec. 2025-10-09 12:16:48 02032_short_circuit_least_greatest_bug: [ OK ] 0.74 sec. 2025-10-09 12:16:49 01084_defaults_on_aliases: [ OK ] 1.28 sec. 2025-10-09 12:16:50 02550_client_connections_credentials: [ OK ] 20.08 sec. 2025-10-09 12:16:51 01763_long_ttl_group_by: [ OK ] 9.17 sec. 2025-10-09 12:16:51 00802_daylight_saving_time_shift_backwards_at_midnight: [ OK ] 0.78 sec. 2025-10-09 12:16:54 01414_low_cardinality_nullable: [ OK ] 6.91 sec. 2025-10-09 12:16:55 01317_no_password_in_command_line: [ OK ] 8.81 sec. 2025-10-09 12:16:55 01477_lc_in_merge_join_left_key: [ OK ] 3.75 sec. 2025-10-09 12:16:55 01761_cast_to_enum_nullable: [ OK ] 0.63 sec. 2025-10-09 12:16:56 02684_bson: [ OK ] 0.63 sec. 2025-10-09 12:16:56 02955_analyzer_using_functional_args: [ OK ] 5.05 sec. 2025-10-09 12:16:56 02357_query_cancellation_race: [ OK ] 8.26 sec. 2025-10-09 12:16:57 00945_bloom_filter_index: [ OK ] 17.60 sec. 2025-10-09 12:16:57 01562_agg_null_for_empty_ahead: [ OK ] 1.34 sec. 2025-10-09 12:16:57 01012_select_limit_x_0: [ OK ] 0.58 sec. 2025-10-09 12:16:58 03162_dynamic_type_nested: [ OK ] 0.78 sec. 2025-10-09 12:16:58 02813_seriesOutliersDetectTukey: [ OK ] 1.44 sec. 2025-10-09 12:16:58 02111_global_context_temporary_tables: [ OK ] 0.73 sec. 2025-10-09 12:16:59 02131_skip_index_not_materialized: [ OK ] 0.94 sec. 2025-10-09 12:16:59 01651_group_uniq_array_enum: [ OK ] 0.80 sec. 2025-10-09 12:16:59 03033_cte_numbers_memory: [ OK ] 0.89 sec. 2025-10-09 12:17:00 01671_aggregate_function_group_bitmap_data: [ OK ] 0.99 sec. 2025-10-09 12:17:00 01715_table_function_view_fix: [ OK ] 0.79 sec. 2025-10-09 12:17:00 01700_point_in_polygon_ubsan: [ OK ] 0.64 sec. 2025-10-09 12:17:01 01620_fix_simple_state_arg_type: [ OK ] 1.04 sec. 2025-10-09 12:17:02 03213_rand_dos: [ OK ] 0.83 sec. 2025-10-09 12:17:03 03208_buffer_over_distributed_type_mismatch: [ OK ] 2.59 sec. 2025-10-09 12:17:04 02454_set_parameters_formatting: [ OK ] 2.20 sec. 2025-10-09 12:17:04 02735_system_zookeeper_connection: [ OK ] 1.09 sec. 2025-10-09 12:17:05 02416_json_tuple_to_array_schema_inference: [ OK ] 0.69 sec. 2025-10-09 12:17:05 02943_variant_element: [ OK ] 1.04 sec. 2025-10-09 12:17:06 00566_enum_min_max: [ OK ] 0.64 sec. 2025-10-09 12:17:06 02950_parallel_replicas_used_count: [ OK ] 8.86 sec. 2025-10-09 12:17:06 02732_rename_after_processing: [ OK ] 7.66 sec. 2025-10-09 12:17:06 02579_parameterized_replace: [ OK ] 0.69 sec. 2025-10-09 12:17:07 02968_url_args: [ OK ] 0.85 sec. 2025-10-09 12:17:07 00910_crash_when_distributed_modify_order_by: [ OK ] 0.74 sec. 2025-10-09 12:17:07 01889_check_row_policy_defined_using_user_function: [ OK ] 11.93 sec. 2025-10-09 12:17:07 02023_storage_filelog: [ OK ] 12.27 sec. 2025-10-09 12:17:07 01014_count_of_merges_metrics: [ OK ] 1.09 sec. 2025-10-09 12:17:08 03321_functions_to_subcolumns_skip_index: [ OK ] 0.99 sec. 2025-10-09 12:17:08 03036_dynamic_read_subcolumns_memory: [ SKIPPED ] 0.00 sec. 2025-10-09 12:17:08 Reason: not running for current build 2025-10-09 12:17:09 02316_cast_to_ip_address_default_column: [ OK ] 1.14 sec. 2025-10-09 12:17:09 01551_mergetree_read_in_order_spread: [ OK ] 0.93 sec. 2025-10-09 12:17:09 01051_new_any_join_engine: [ OK ] 2.29 sec. 2025-10-09 12:17:10 01067_join_null: [ OK ] 0.84 sec. 2025-10-09 12:17:10 01448_json_compact_strings_each_row: [ OK ] 2.54 sec. 2025-10-09 12:17:10 01034_unknown_qualified_column_in_join: [ OK ] 0.64 sec. 2025-10-09 12:17:10 01914_ubsan_quantile_timing: [ OK ] 0.74 sec. 2025-10-09 12:17:11 01528_allow_nondeterministic_optimize_skip_unused_shards: [ OK ] 0.83 sec. 2025-10-09 12:17:11 01720_union_distinct_with_limit: [ OK ] 0.68 sec. 2025-10-09 12:17:11 00534_functions_bad_arguments11: [ OK ] 36.87 sec. 2025-10-09 12:17:12 01475_read_subcolumns_3: [ OK ] 1.54 sec. 2025-10-09 12:17:12 02149_issue_32487: [ OK ] 0.63 sec. 2025-10-09 12:17:13 02575_map_hashing_msan: [ OK ] 0.99 sec. 2025-10-09 12:17:14 00593_union_all_assert_columns_removed: [ OK ] 0.84 sec. 2025-10-09 12:17:15 02383_arrow_dict_special_cases: [ OK ] 8.11 sec. 2025-10-09 12:17:16 02697_stop_reading_on_first_cancel: [ OK ] 2.69 sec. 2025-10-09 12:17:17 01406_carriage_return_in_tsv_csv: [ OK ] 4.40 sec. 2025-10-09 12:17:17 02124_insert_deduplication_token_materialized_views: [ OK ] 6.76 sec. 2025-10-09 12:17:17 02398_subquery_where_pushdown_and_limit_offset: [ OK ] 0.83 sec. 2025-10-09 12:17:17 03206_is_null_constant_result_old_analyzer_bug: [ OK ] 1.03 sec. 2025-10-09 12:17:18 00209_insert_select_extremes: [ OK ] 0.84 sec. 2025-10-09 12:17:19 02900_issue_55858: [ OK ] 1.14 sec. 2025-10-09 12:17:19 02566_analyzer_limit_settings_distributed: [ OK ] 1.28 sec. 2025-10-09 12:17:19 00904_array_with_constant_2: [ OK ] 0.83 sec. 2025-10-09 12:17:21 02498_random_string_in_json_schema_inference: [ OK ] 2.29 sec. 2025-10-09 12:17:22 02470_suspicious_low_cardinality_msan: [ OK ] 1.04 sec. 2025-10-09 12:17:22 00825_protobuf_format_persons: [ OK ] 17.34 sec. 2025-10-09 12:17:24 02024_compression_in_query: [ OK ] 8.67 sec. 2025-10-09 12:17:24 02763_row_policy_storage_merge_alias: [ OK ] 1.95 sec. 2025-10-09 12:17:24 03201_avro_negative_block_size_arrays: [ OK ] 2.59 sec. 2025-10-09 12:17:25 02354_tuple_element_with_default: [ OK ] 1.04 sec. 2025-10-09 12:17:26 02041_openssl_hash_functions_test: [ OK ] 0.89 sec. 2025-10-09 12:17:29 00825_protobuf_format_splitted_nested: [ OK ] 5.26 sec. 2025-10-09 12:17:31 00386_long_in_pk: [ OK ] 41.68 sec. 2025-10-09 12:17:31 02677_analyzer_compound_expressions: [ OK ] 1.54 sec. 2025-10-09 12:17:32 01318_map_populate_series: [ OK ] 1.59 sec. 2025-10-09 12:17:32 02998_to_milliseconds: [ OK ] 1.24 sec. 2025-10-09 12:17:33 03093_filter_push_down_crash: [ OK ] 0.99 sec. 2025-10-09 12:17:34 02841_tuple_modulo: [ OK ] 0.81 sec. 2025-10-09 12:17:35 02240_asof_join_biginteger: [ OK ] 0.94 sec. 2025-10-09 12:17:35 02792_alter_table_modify_comment: [ OK ] 2.99 sec. 2025-10-09 12:17:36 00183_skip_unavailable_shards: [ OK ] 24.87 sec. 2025-10-09 12:17:38 03168_query_log_privileges_not_empty: [ OK ] 11.93 sec. 2025-10-09 12:17:39 00989_parallel_parts_loading: [ OK ] 15.04 sec. 2025-10-09 12:17:39 02129_skip_quoted_fields: [ OK ] 19.86 sec. 2025-10-09 12:17:40 00522_multidimensional: [ OK ] 4.30 sec. 2025-10-09 12:17:40 01780_column_sparse_full: [ OK ] 4.63 sec. 2025-10-09 12:17:40 03203_multiif_and_where_2_conditions_old_analyzer_bug: [ OK ] 1.04 sec. 2025-10-09 12:17:41 01611_string_to_low_cardinality_key_alter: [ OK ] 1.44 sec. 2025-10-09 12:17:41 01490_nullable_string_to_enum: [ OK ] 0.78 sec. 2025-10-09 12:17:41 00700_to_decimal_or_something_1: [ OK ] 5.21 sec. 2025-10-09 12:17:42 01942_dateTimeToSnowflakeID: [ OK ] 1.49 sec. 2025-10-09 12:17:43 02864_replace_regexp_string_fallback: [ OK ] 0.99 sec. 2025-10-09 12:17:43 00619_union_highlite: [ OK ] 0.84 sec. 2025-10-09 12:17:44 02845_parquet_odd_decimals: [ OK ] 4.05 sec. 2025-10-09 12:17:44 02597_projection_materialize_and_replication: [ OK ] 2.54 sec. 2025-10-09 12:17:44 00763_long_lock_buffer_alter_destination_table: [ OK ] 35.67 sec. 2025-10-09 12:17:45 02508_index_analysis_to_date_timezone: [ OK ] 1.04 sec. 2025-10-09 12:17:45 02480_tets_show_full: [ OK ] 3.41 sec. 2025-10-09 12:17:45 01277_fromUnixTimestamp64: [ OK ] 1.23 sec. 2025-10-09 12:17:45 02354_vector_search_default_granularity: [ OK ] 0.94 sec. 2025-10-09 12:17:45 00613_shard_distributed_max_execution_time: [ OK ] 0.73 sec. 2025-10-09 12:17:46 01040_h3_get_resolution: [ OK ] 0.78 sec. 2025-10-09 12:17:46 01324_settings_documentation: [ OK ] 0.79 sec. 2025-10-09 12:17:46 00825_protobuf_format_squares: [ OK ] 5.10 sec. 2025-10-09 12:17:47 01960_lambda_precedence: [ OK ] 0.70 sec. 2025-10-09 12:17:47 01746_long_zlib_http_compression_json_format: [ OK ] 2.24 sec. 2025-10-09 12:17:47 00955_complex_prepared_statements: [ OK ] 8.77 sec. 2025-10-09 12:17:47 01283_max_threads_simple_query_optimization: [ OK ] 2.34 sec. 2025-10-09 12:17:47 2025-10-09 12:17:47 373 tests passed. 7 tests skipped. 1354.83 s elapsed (Process-7). 2025-10-09 12:17:48 01699_timezoneOffset: [ OK ] 1.79 sec. 2025-10-09 12:17:48 2025-10-09 12:17:48 Having 1 errors! 384 tests passed. 6 tests skipped. 1355.58 s elapsed (Process-10). 2025-10-09 12:17:48 00712_prewhere_with_final: [ OK ] 0.93 sec. 2025-10-09 12:17:48 2025-10-09 12:17:48 Having 1 errors! 377 tests passed. 7 tests skipped. 1355.69 s elapsed (Process-4). 2025-10-09 12:17:48 01621_clickhouse_compressor: [ OK ] 2.47 sec. 2025-10-09 12:17:48 2025-10-09 12:17:48 431 tests passed. 4 tests skipped. 1355.73 s elapsed (Process-8). 2025-10-09 12:17:48 02354_vector_search_bugs: [ OK ] 1.44 sec. 2025-10-09 12:17:48 2025-10-09 12:17:48 372 tests passed. 4 tests skipped. 1355.98 s elapsed (Process-3). 2025-10-09 12:17:50 00719_parallel_ddl_db: [ OK ] 31.15 sec. 2025-10-09 12:17:50 2025-10-09 12:17:50 346 tests passed. 4 tests skipped. 1357.45 s elapsed (Process-6). 2025-10-09 12:17:54 02488_zero_copy_detached_parts_drop_table: [ OK ] 8.96 sec. 2025-10-09 12:17:54 2025-10-09 12:17:54 502 tests passed. 6 tests skipped. 1361.16 s elapsed (Process-9). 2025-10-09 12:17:58 01715_background_checker_blather_zookeeper_long: [ OK ] 11.22 sec. 2025-10-09 12:17:58 2025-10-09 12:17:58 418 tests passed. 7 tests skipped. 1365.59 s elapsed (Process-5). 2025-10-09 12:18:05 Running 281 stateless tests (MainProcess). 2025-10-09 12:18:14 03231_restore_user_with_existing_role: [ OK ] 9.31 sec. 2025-10-09 12:18:20 03206_replication_lag_metric: [ OK ] 5.85 sec. 2025-10-09 12:18:21 03198_table_function_directory_path: [ OK ] 0.93 sec. 2025-10-09 12:18:22 03198_dynamic_read_subcolumns: [ OK ] 1.63 sec. 2025-10-09 12:18:23 03168_loop_engine_with_parallel_replicas: [ OK ] 0.74 sec. 2025-10-09 12:18:27 03154_lazy_token_iterator: [ OK ] 3.79 sec. 2025-10-09 12:18:53 03151_unload_index_race: [ OK ] 25.78 sec. 2025-10-09 12:18:53 03147_system_columns_access_checks: [ SKIPPED ] 0.00 sec. 2025-10-09 12:18:53 Reason: not running for current build 2025-10-09 12:18:55 03147_parquet_memory_tracking: [ OK ] 1.79 sec. 2025-10-09 12:18:56 03147_table_function_loop: [ OK ] 0.85 sec. 2025-10-09 12:21:36 03008_deduplication_mv_generates_several_blocks_replicated: [ OK ] 160.61 sec. 2025-10-09 12:21:45 03008_s3_plain_rewritable_fault: [ OK ] 8.96 sec. 2025-10-09 12:23:47 03008_deduplication_several_mv_into_one_table_nonreplicated: [ OK ] 121.21 sec. 2025-10-09 12:25:43 03008_deduplication_insert_several_blocks_nonreplicated: [ OK ] 116.75 sec. 2025-10-09 12:27:52 03008_deduplication_insert_several_blocks_replicated: [ OK ] 129.09 sec. 2025-10-09 12:27:59 03002_part_log_rmt_fetch_merge_error: [ OK ] 6.70 sec. 2025-10-09 12:28:08 03002_part_log_rmt_fetch_mutate_error: [ OK ] 8.71 sec. 2025-10-09 12:28:09 02990_rmt_replica_path_uuid: [ OK ] 0.88 sec. 2025-10-09 12:28:19 02980_dist_insert_readonly_replica: [ OK ] 10.26 sec. 2025-10-09 12:28:24 02973_backup_of_in_memory_compressed: [ OK ] 5.15 sec. 2025-10-09 12:29:26 02962_system_sync_replica_lightweight_from_modifier: [ OK ] 61.74 sec. 2025-10-09 12:29:28 02961_drop_tables: [ OK ] 1.59 sec. 2025-10-09 12:29:29 02960_partition_by_udf: [ OK ] 0.94 sec. 2025-10-09 12:29:42 02944_dynamically_change_filesystem_cache_size: [ OK ] 12.98 sec. 2025-10-09 12:29:53 02943_rmt_alter_metadata_merge_checksum_mismatch: [ OK ] 10.32 sec. 2025-10-09 12:29:55 02931_max_num_to_warn: [ OK ] 1.99 sec. 2025-10-09 12:30:01 02916_move_partition_inactive_replica: [ OK ] 5.98 sec. 2025-10-09 12:30:06 02915_move_partition_inactive_replica: [ OK ] 5.65 sec. 2025-10-09 12:30:08 02911_row_policy_on_cluster: [ OK ] 1.09 sec. 2025-10-09 12:30:08 02910_prefetch_unexpceted_exception: [ OK ] 0.74 sec. 2025-10-09 12:30:09 02908_empty_named_collection: [ OK ] 0.63 sec. 2025-10-09 12:30:09 02908_many_requests_to_system_replicas: [ SKIPPED ] 0.00 sec. 2025-10-09 12:30:09 Reason: not running for current build 2025-10-09 12:30:18 02888_replicated_merge_tree_creation: [ OK ] 9.22 sec. 2025-10-09 12:30:20 02887_insert_quorum_wo_keeper_retries: [ OK ] 1.49 sec. 2025-10-09 12:30:24 02884_async_insert_skip_settings: [ OK ] 3.65 sec. 2025-10-09 12:30:30 02884_async_insert_native_protocol_3: [ OK ] 6.71 sec. 2025-10-09 12:30:30 02874_parquet_multiple_batches_array_inconsistent_offsets: [ SKIPPED ] 0.00 sec. 2025-10-09 12:30:30 Reason: not running for current build 2025-10-09 12:30:58 02871_peak_threads_usage: [ OK ] 27.39 sec. 2025-10-09 12:30:58 02867_create_user_ssh: [ OK ] 0.64 sec. 2025-10-09 12:31:00 02863_delayed_source_with_totals_and_extremes: [ OK ] 1.34 sec. 2025-10-09 12:31:12 02845_threads_count_in_distributed_queries: [ OK ] 12.65 sec. 2025-10-09 12:31:15 02843_insertion_table_schema_infer: [ OK ] 2.29 sec. 2025-10-09 12:31:30 02841_parquet_filter_pushdown: [ OK ] 15.55 sec. 2025-10-09 12:31:32 02833_multiprewhere_extra_column: [ OK ] 1.94 sec. 2025-10-09 12:31:41 02808_filesystem_cache_drop_query: [ OK ] 8.47 sec. 2025-10-09 12:31:47 02796_calculate_text_stack_trace: [ OK ] 5.70 sec. 2025-10-09 12:31:56 02789_filesystem_cache_alignment: [ OK ] 9.37 sec. 2025-10-09 12:32:00 02789_table_functions_errors: [ OK ] 3.45 sec. 2025-10-09 12:32:00 02782_uniq_exact_parallel_merging_bug: [ SKIPPED ] 0.00 sec. 2025-10-09 12:32:00 Reason: not running for current build 2025-10-09 12:32:02 02775_show_columns_called_from_mysql: [ OK ] 2.44 sec. 2025-10-09 12:32:03 02762_replicated_database_no_args: [ OK ] 0.69 sec. 2025-10-09 12:32:06 02751_ip_types_aggregate_functions_states: [ OK ] 3.39 sec. 2025-10-09 12:32:10 02736_reading_and_writing_structure_fields: [ OK ] 3.90 sec. 2025-10-09 12:32:13 02735_capnp_case_insensitive_names_matching: [ OK ] 2.20 sec. 2025-10-09 12:32:51 02735_parquet_encoder: [ OK ] 38.12 sec. 2025-10-09 12:32:52 02725_url_support_virtual_column: [ OK ] 1.04 sec. 2025-10-09 12:33:24 02725_start_stop_fetches: [ OK ] 32.54 sec. 2025-10-09 12:33:25 02710_default_replicated_parameters: [ OK ] 0.68 sec. 2025-10-09 12:33:27 02706_show_columns: [ OK ] 2.24 sec. 2025-10-09 12:33:39 02700_s3_part_INT_MAX: [ FAIL ] 12.07 sec. 2025-10-09 12:33:39 Reason: return code: 241 2025-10-09 12:33:39 [042507aae095] 2025.10.09 12:33:39.450923 [ 152513 ] {5239250e-6eaf-4727-87f9-b81f2c37275f} executeQuery: Code: 241. DB::Exception: Memory limit (total) exceeded: would use 29.73 GiB (attempt to allocate chunk of 4294967359 bytes), maximum: 27.54 GiB. OvercommitTracker decision: Query was selected to stop by OvercommitTracker. (MEMORY_LIMIT_EXCEEDED) (version 24.8.14.10503.altinitytest (altinity build)) (from [::1]:40766) (comment: 02700_s3_part_INT_MAX.sh) (in query: INSERT INTO FUNCTION s3('http://localhost:11111/test/test_unnau5zd/test_INT_MAX.tsv', '', '[HIDDEN]', 'TSV') SETTINGS s3_max_single_part_upload_size = '5Gi' SELECT repeat('a', 1024) FROM numbers((pow(2, 30) * 2) / 1024) SETTINGS s3_max_single_part_upload_size = '5Gi'), Stack trace (when copying this message, always include the lines below): 2025-10-09 12:33:39 2025-10-09 12:33:39 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x000000003435ea14 2025-10-09 12:33:39 1. ./build_docker/./src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000001adb2269 2025-10-09 12:33:39 2. DB::Exception::Exception(PreformattedMessage&&, int) @ 0x000000000aa90445 2025-10-09 12:33:39 3. ./src/Common/LoggingFormatStringHelpers.h:45: DB::Exception::Exception>>(int, FormatStringHelperImpl::type, std::type_identity::type, std::type_identity::type, std::type_identity::type, std::type_identity::type, std::type_identity::type, std::type_identity>>::type>, char const*&&, char const*&&, String&&, long&, String&&, char const*&&, std::basic_string_view>&&) @ 0x000000001adfe65d 2025-10-09 12:33:39 4. ./build_docker/./src/Common/MemoryTracker.cpp:343: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001adfcddf 2025-10-09 12:33:39 5. ./build_docker/./src/Common/MemoryTracker.cpp:0: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001adfc777 2025-10-09 12:33:39 6. ./build_docker/./src/Common/MemoryTracker.cpp:0: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001adfc777 2025-10-09 12:33:39 7. ./build_docker/./src/Common/MemoryTracker.cpp:0: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001adfc777 2025-10-09 12:33:39 8. ./build_docker/./src/Common/CurrentMemoryTracker.cpp:59: CurrentMemoryTracker::alloc(long) @ 0x000000001ad3489d 2025-10-09 12:33:39 9. ./build_docker/./src/Common/Allocator.cpp:0: Allocator::realloc(void*, unsigned long, unsigned long, unsigned long) @ 0x000000001ad313ff 2025-10-09 12:33:39 10. ./src/IO/BufferWithOwnMemory.h:101: DB::Memory>::resize(unsigned long) @ 0x000000001aef4022 2025-10-09 12:33:39 11. ./src/IO/BufferWithOwnMemory.h:80: DB::WriteBufferFromS3::reallocateFirstBuffer() @ 0x0000000026aebaae 2025-10-09 12:33:39 12. ./src/IO/BufferBase.h:41: DB::WriteBufferFromS3::nextImpl() @ 0x0000000026aeb0cb 2025-10-09 12:33:39 13. DB::WriteBuffer::write(char const*, unsigned long) @ 0x000000000aacfe3b 2025-10-09 12:33:39 14. ./build_docker/./src/Processors/Formats/Impl/ParallelFormattingOutputFormat.cpp:0: DB::ParallelFormattingOutputFormat::collectorThreadFunction(std::shared_ptr const&) @ 0x000000002d6fbbea 2025-10-09 12:33:39 15. ./src/Common/ThreadPool.h:312: ThreadFromGlobalPoolImpl::ThreadFromGlobalPoolImpl(DB::ParallelFormattingOutputFormat::ParallelFormattingOutputFormat(DB::ParallelFormattingOutputFormat::Params)::'lambda'()&&)::'lambda'()::operator()() @ 0x000000002d22458b 2025-10-09 12:33:39 16. ./contrib/llvm-project/libcxx/include/__functional/function.h:0: ? @ 0x000000001af7bc52 2025-10-09 12:33:39 17. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: void* std::__thread_proxy[abi:v15007]>, void (ThreadPoolImpl::ThreadFromThreadPool::*)(), ThreadPoolImpl::ThreadFromThreadPool*>>(void*) @ 0x000000001af88055 2025-10-09 12:33:39 18. asan_thread_start(void*) @ 0x000000000aa45059 2025-10-09 12:33:39 19. ? @ 0x00007f9653928ac3 2025-10-09 12:33:39 20. ? @ 0x00007f96539ba850 2025-10-09 12:33:39 2025-10-09 12:33:39 [042507aae095] 2025.10.09 12:33:39.452771 [ 152513 ] {5239250e-6eaf-4727-87f9-b81f2c37275f} WriteBufferFromS3: Nothing to abort. Details: bucket test, key test_unnau5zd/test_INT_MAX.tsv, total size 0, count 2147483648, hidden_size 2147483648, offset 0, with pool: true, prefinalized false, finalized false 2025-10-09 12:33:39 Received exception from server (version 24.8.14): 2025-10-09 12:33:39 Code: 241. DB::Exception: Received from localhost:9000. DB::Exception: Memory limit (total) exceeded: would use 29.73 GiB (attempt to allocate chunk of 4294967359 bytes), maximum: 27.54 GiB. OvercommitTracker decision: Query was selected to stop by OvercommitTracker.. (MEMORY_LIMIT_EXCEEDED) 2025-10-09 12:33:39 (query: INSERT INTO FUNCTION s3('http://localhost:11111/test/test_unnau5zd/test_INT_MAX.tsv', '', '', 'TSV') 2025-10-09 12:33:39 SELECT repeat('a', 1024) FROM numbers((pow(2, 30) * 2) / 1024) 2025-10-09 12:33:39 SETTINGS s3_max_single_part_upload_size = '5Gi';) 2025-10-09 12:33:39 , result: 2025-10-09 12:33:39 2025-10-09 12:33:39 2025-10-09 12:33:39 2025-10-09 12:33:39 stdout: 2025-10-09 12:33:39 2025-10-09 12:33:39 2025-10-09 12:33:39 Settings used in the test: --max_insert_threads 2 --group_by_two_level_threshold 335950 --group_by_two_level_threshold_bytes 754289 --distributed_aggregation_memory_efficient 0 --fsync_metadata 1 --output_format_parallel_formatting 1 --input_format_parallel_parsing 1 --min_chunk_bytes_for_parallel_parsing 4422744 --max_read_buffer_size 506873 --prefer_localhost_replica 1 --max_block_size 51150 --max_joined_block_size_rows 46768 --max_threads 1 --optimize_append_index 0 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 1 --optimize_read_in_order 0 --optimize_or_like_chain 1 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 0 --read_in_order_two_level_merge_threshold 29 --optimize_aggregation_in_order 0 --aggregation_in_order_max_block_bytes 8180502 --use_uncompressed_cache 0 --min_bytes_to_use_direct_io 10737418240 --min_bytes_to_use_mmap_io 10737418240 --local_filesystem_read_method io_uring --remote_filesystem_read_method threadpool --local_filesystem_read_prefetch 0 --filesystem_cache_segments_batch_size 50 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 0 --throw_on_error_from_cache_on_write_operations 0 --remote_filesystem_read_prefetch 1 --allow_prefetched_read_pool_for_remote_filesystem 1 --filesystem_prefetch_max_memory_usage 32Mi --filesystem_prefetches_limit 10 --filesystem_prefetch_min_bytes_for_single_read_task 16Mi --filesystem_prefetch_step_marks 0 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 0 --compile_sort_description 0 --merge_tree_coarse_index_granularity 10 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 10737418240 --max_bytes_before_external_group_by 10737418240 --max_bytes_before_remerge_sort 463981884 --min_compress_block_size 81011 --max_compress_block_size 130547 --merge_tree_compact_parts_min_granules_to_multibuffer_read 108 --optimize_sorting_by_input_stream_properties 1 --http_response_buffer_size 1090734 --http_wait_end_of_query True --enable_memory_bound_merging_of_aggregation_results 0 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 3 --min_count_to_compile_sort_description 0 --session_timezone America/Paramaribo --use_page_cache_for_disks_without_file_cache False --page_cache_inject_eviction False --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.91 --prefer_external_sort_block_bytes 100000000 --cross_join_min_rows_to_compress 1 --cross_join_min_bytes_to_compress 1 --min_external_table_block_size_bytes 100000000 --max_parsing_threads 0 --optimize_functions_to_subcolumns 1 --parallel_replicas_local_plan 1 2025-10-09 12:33:39 2025-10-09 12:33:39 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 1.0 --prefer_fetch_merged_part_size_threshold 10737418240 --vertical_merge_algorithm_min_rows_to_activate 87927 --vertical_merge_algorithm_min_columns_to_activate 100 --allow_vertical_merges_from_compact_to_wide_parts 0 --min_merge_bytes_to_use_direct_io 10737418240 --index_granularity_bytes 1679668 --merge_max_block_size 18473 --index_granularity 50520 --min_bytes_for_wide_part 151821743 --marks_compress_block_size 59960 --primary_key_compress_block_size 80547 --replace_long_file_name_to_hash 0 --max_file_name_length 81 --min_bytes_for_full_part_storage 536870912 --compact_parts_max_bytes_to_buffer 210194733 --compact_parts_max_granules_to_buffer 36 --compact_parts_merge_max_bytes_to_prefetch_part 22377499 --cache_populated_by_fetch 1 --concurrent_part_removal_threshold 100 --old_parts_lifetime 480 2025-10-09 12:33:39 2025-10-09 12:33:39 Database: test_unnau5zd 2025-10-09 12:33:39 02581_share_big_sets_between_mutation_tasks_long: [ SKIPPED ] 0.00 sec. 2025-10-09 12:33:39 Reason: not running for current build 2025-10-09 12:33:45 02572_system_logs_materialized_views_ignore_errors: [ OK ] 5.05 sec. 2025-10-09 12:33:51 02566_ipv4_ipv6_binary_formats: [ OK ] 6.80 sec. 2025-10-09 12:33:53 02561_temporary_table_sessions: [ OK ] 1.89 sec. 2025-10-09 12:33:55 02541_arrow_duration_type: [ OK ] 2.14 sec. 2025-10-09 12:34:31 02535_max_parallel_replicas_custom_key_mt: [ OK ] 35.80 sec. 2025-10-09 12:35:07 02535_max_parallel_replicas_custom_key_rmt: [ OK ] 35.29 sec. 2025-10-09 12:35:09 02522_avro_complicate_schema: [ OK ] 2.14 sec. 2025-10-09 12:36:07 02515_cleanup_async_insert_block_ids: [ OK ] 58.48 sec. 2025-10-09 12:36:10 02510_orc_map_indexes: [ OK ] 2.35 sec. 2025-10-09 12:36:15 02503_cache_on_write_with_small_segment_size: [ OK ] 5.10 sec. 2025-10-09 12:36:22 02503_insert_storage_snapshot: [ OK ] 6.60 sec. 2025-10-09 12:36:25 02501_deep_recusion_schema_inference: [ OK ] 2.90 sec. 2025-10-09 12:36:25 02497_trace_events_stress_long: [ SKIPPED ] 0.00 sec. 2025-10-09 12:36:25 Reason: not running for current build 2025-10-09 12:36:26 02495_s3_filter_by_file: [ OK ] 1.39 sec. 2025-10-09 12:36:27 02494_query_cache_user_quotas_after_drop: [ OK ] 1.04 sec. 2025-10-09 12:36:33 02494_query_cache_query_log: [ OK ] 5.75 sec. 2025-10-09 12:36:35 02494_query_cache_case_agnostic_matching: [ OK ] 1.94 sec. 2025-10-09 12:36:36 02494_query_cache_compression: [ OK ] 0.93 sec. 2025-10-09 12:36:37 02494_query_cache_totals_extremes: [ OK ] 1.39 sec. 2025-10-09 12:36:38 02494_query_cache_exception_handling: [ OK ] 0.64 sec. 2025-10-09 12:36:39 02494_query_cache_eligible_queries: [ OK ] 1.18 sec. 2025-10-09 12:36:46 02494_query_cache_ttl_long: [ OK ] 6.76 sec. 2025-10-09 12:36:48 02494_query_cache_events: [ OK ] 1.84 sec. 2025-10-09 12:36:56 02494_trace_log_profile_events: [ OK ] 7.76 sec. 2025-10-09 12:36:57 02494_query_cache_bugs: [ OK ] 0.99 sec. 2025-10-09 12:36:58 02494_query_cache_squash_partial_results: [ OK ] 1.69 sec. 2025-10-09 12:36:59 02484_substitute_udf_storage_args: [ OK ] 0.99 sec. 2025-10-09 12:37:00 02483_check_virtuals_shile_using_structure_from_insertion_table: [ OK ] 0.74 sec. 2025-10-09 12:37:04 02483_capnp_decimals: [ OK ] 3.64 sec. 2025-10-09 12:37:06 02482_new_json_nested_arrays_with_same_keys: [ OK ] 2.14 sec. 2025-10-09 12:37:08 02482_json_nested_arrays_with_same_keys: [ OK ] 2.14 sec. 2025-10-09 12:37:12 02481_custom_separated_and_template_with_csv_field: [ OK ] 3.44 sec. 2025-10-09 12:37:16 02459_glob_for_recursive_directory_traversal: [ OK ] 4.60 sec. 2025-10-09 12:37:18 02458_hdfs_cluster_schema_inference: [ OK ] 1.29 sec. 2025-10-09 12:37:22 02440_mutations_finalization: [ OK ] 4.15 sec. 2025-10-09 12:37:23 02422_msgpack_uuid_wrong_column: [ OK ] 0.78 sec. 2025-10-09 12:37:23 02422_allow_implicit_no_password: [ SKIPPED ] 0.00 sec. 2025-10-09 12:37:23 Reason: not running for current build 2025-10-09 12:37:33 02421_record_errors_row_by_input_format: [ OK ] 10.17 sec. 2025-10-09 12:37:34 02411_merge_tree_zero_max_read_buffer_size: [ OK ] 0.78 sec. 2025-10-09 12:37:36 02404_schema_inference_cache_respect_format_settings: [ OK ] 2.34 sec. 2025-10-09 12:37:36 02397_system_parts_race_condition_drop_rm: [ SKIPPED ] 0.00 sec. 2025-10-09 12:37:36 Reason: disabled 2025-10-09 12:37:36 02396_system_parts_race_condition_rm: [ SKIPPED ] 0.00 sec. 2025-10-09 12:37:36 Reason: disabled 2025-10-09 12:37:38 02391_recursive_buffer: [ OK ] 1.09 sec. 2025-10-09 12:37:39 02385_profile_events_overflow: [ OK ] 1.29 sec. 2025-10-09 12:37:40 02376_arrow_dict_with_string: [ OK ] 0.74 sec. 2025-10-09 12:37:42 02373_heap_buffer_overflow_in_avro: [ OK ] 2.54 sec. 2025-10-09 12:38:07 02352_rwlock: [ OK ] 24.28 sec. 2025-10-09 12:38:10 02350_views_max_insert_threads: [ OK ] 2.80 sec. 2025-10-09 12:38:11 02346_additional_filters_distr: [ OK ] 1.14 sec. 2025-10-09 12:38:15 02337_drop_filesystem_cache_access: [ OK ] 4.66 sec. 2025-10-09 12:38:16 02323_null_modifier_in_table_function: [ OK ] 0.89 sec. 2025-10-09 12:38:18 02313_avro_records_and_maps: [ OK ] 1.50 sec. 2025-10-09 12:38:21 02311_system_zookeeper_insert_priv: [ OK ] 3.05 sec. 2025-10-09 12:38:22 02304_orc_arrow_parquet_string_as_string: [ OK ] 0.94 sec. 2025-10-09 12:38:36 02294_overcommit_overflow: [ OK ] 14.07 sec. 2025-10-09 12:39:38 02286_mysql_dump_input_format: [ OK ] 61.76 sec. 2025-10-09 12:39:45 02262_column_ttl: [ OK ] 6.82 sec. 2025-10-09 12:40:03 02247_written_bytes_quota: [ OK ] 18.62 sec. 2025-10-09 12:40:04 02244_lowcardinality_hash_join: [ OK ] 0.94 sec. 127.0.0.1 - - [09/Oct/2025:15:40:20 +0000] "PUT /devstoreaccount1/cont/tgvulcatykcpkurzpzdjskafoqjvkunt HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:40:21 +0000] "PUT /devstoreaccount1/cont/umdchhwzkygawqvwsphsuhipqzvzmhcc HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:40:21 +0000] "PUT /devstoreaccount1/cont/pnhvdzkrrlrfnlstmftjibgmcqxtgfzw HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:40:21 +0000] "PUT /devstoreaccount1/cont/wkpxwgsueikrhazdgwkkiuvbijlbwvsh HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:40:21 +0000] "PUT /devstoreaccount1/cont/fpwiemporrkdluuzfxsrssifmvrvmekm HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:40:21 +0000] "PUT /devstoreaccount1/cont/axdvmovgqtlooujyyuqwhkeowpwvcpnm HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:40:21 +0000] "PUT /devstoreaccount1/cont/pqbgldybkywtasvdqhyoaigskyrpzkci HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:40:21 +0000] "PUT /devstoreaccount1/cont/alnywprnytqpjojwguubxiaubuipwnlm HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:40:21 +0000] "PUT /devstoreaccount1/cont/ijauikufmmeopuecmvlsibwagpohpydr HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:40:21 +0000] "PUT /devstoreaccount1/cont/ihzbwyvcqnclslbvzcteucddkbcgfpcr HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:40:21 +0000] "GET /devstoreaccount1/cont/pnhvdzkrrlrfnlstmftjibgmcqxtgfzw HTTP/1.1" 206 520 127.0.0.1 - - [09/Oct/2025:15:40:21 +0000] "GET /devstoreaccount1/cont/umdchhwzkygawqvwsphsuhipqzvzmhcc HTTP/1.1" 206 808111 127.0.0.1 - - [09/Oct/2025:15:40:26 +0000] "DELETE /devstoreaccount1/cont/ihzbwyvcqnclslbvzcteucddkbcgfpcr HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:40:26 +0000] "DELETE /devstoreaccount1/cont/pqbgldybkywtasvdqhyoaigskyrpzkci HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:40:26 +0000] "DELETE /devstoreaccount1/cont/fpwiemporrkdluuzfxsrssifmvrvmekm HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:40:26 +0000] "DELETE /devstoreaccount1/cont/umdchhwzkygawqvwsphsuhipqzvzmhcc HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:40:26 +0000] "DELETE /devstoreaccount1/cont/pnhvdzkrrlrfnlstmftjibgmcqxtgfzw HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:40:26 +0000] "DELETE /devstoreaccount1/cont/wkpxwgsueikrhazdgwkkiuvbijlbwvsh HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:40:26 +0000] "DELETE /devstoreaccount1/cont/axdvmovgqtlooujyyuqwhkeowpwvcpnm HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:40:26 +0000] "DELETE /devstoreaccount1/cont/ijauikufmmeopuecmvlsibwagpohpydr HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:40:26 +0000] "DELETE /devstoreaccount1/cont/alnywprnytqpjojwguubxiaubuipwnlm HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:40:26 +0000] "DELETE /devstoreaccount1/cont/tgvulcatykcpkurzpzdjskafoqjvkunt HTTP/1.1" 202 - 2025-10-09 12:40:26 02242_system_filesystem_cache_log_table: [ OK ] 21.74 sec. 2025-10-09 12:40:40 02242_delete_user_race: [ OK ] 13.54 sec. 127.0.0.1 - - [09/Oct/2025:15:41:17 +0000] "PUT /devstoreaccount1/cont/ohhravsccsmjbyndvwdeakfmkspaxfxl HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:19 +0000] "PUT /devstoreaccount1/cont/peewsrusyrhxciexiogszpfwcqrwwiik HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:19 +0000] "PUT /devstoreaccount1/cont/hhnwfvtqdhbbswoyqwvzmysvpsfyembp HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:19 +0000] "PUT /devstoreaccount1/cont/ipssncguhuolzujnlrxlfmudgqzbascc HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:19 +0000] "PUT /devstoreaccount1/cont/jrbhhtyzopedykpqdjjrjvycassmrobs HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:19 +0000] "PUT /devstoreaccount1/cont/wfqcgwquzigpoayghaluolqjstxdybiq HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:19 +0000] "PUT /devstoreaccount1/cont/fpfrjqltravnddsrlllpypqmcsviqjcm HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:19 +0000] "PUT /devstoreaccount1/cont/djzmjnihdqatyddhckttxqrgorwhjrqz HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:19 +0000] "PUT /devstoreaccount1/cont/hwcdnkdohhztpyuepbfcwimsppeuibbx HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:23 +0000] "PUT /devstoreaccount1/cont/acngmrpvvqgmtiamgmpygfyefccsayve HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:23 +0000] "PUT /devstoreaccount1/cont/bebwkhsgrhsvuuhyaeupdxihgjprxvrr HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:23 +0000] "PUT /devstoreaccount1/cont/dklakzrfoqebwfwknadrwzstcbaeaiee HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:23 +0000] "PUT /devstoreaccount1/cont/wfsyhcpihkhhhpcpqpmtjylvrcqrxonc HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:23 +0000] "PUT /devstoreaccount1/cont/xzisehqqpdqijtoyhlxgdnirndgqhnhb HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:23 +0000] "PUT /devstoreaccount1/cont/wiztnsfqrwuaatwjcuwqwtdjqmaauubh HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:23 +0000] "PUT /devstoreaccount1/cont/fyeiynhwuwuddmuyskxukmnfwvdahumh HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:23 +0000] "PUT /devstoreaccount1/cont/esefuzvubetolgzvwfpwanbypycsyyas HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:25 +0000] "PUT /devstoreaccount1/cont/eictqsqafkmuvvhszkhycecbdsvrrwpz HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:25 +0000] "PUT /devstoreaccount1/cont/duenetumoscppglhzsmhvzljkulvttbk HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:25 +0000] "PUT /devstoreaccount1/cont/uxhciiqosnrnbwguzydvorbpmqchspcb HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:25 +0000] "PUT /devstoreaccount1/cont/aikmkadwgcqpcbfatvjhrornhiemswxs HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:25 +0000] "PUT /devstoreaccount1/cont/henopvpspvshzxixnnfpsatzustsgpbw HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:25 +0000] "PUT /devstoreaccount1/cont/qozqicuxkvnvjukkuhlfrhsppichewnb HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:25 +0000] "PUT /devstoreaccount1/cont/ewiyccebbictfscsafhagnirmhtxauev HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:25 +0000] "PUT /devstoreaccount1/cont/eumiodxehqohsrfptjftiviyowyrzhxw HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:25 +0000] "PUT /devstoreaccount1/cont/ozohnpbgwizuqcgpyatwnknrhtymfbct HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:25 +0000] "PUT /devstoreaccount1/cont/flebyvqxsiaorxhonuoyvlujyktgorgj HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:25 +0000] "PUT /devstoreaccount1/cont/glezmngcaygeumdvbvglxrdjfnbozekh HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:25 +0000] "PUT /devstoreaccount1/cont/rotnzfjoqprxskidmfbjcajspykwqeul HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:25 +0000] "PUT /devstoreaccount1/cont/rbnpnpjucjlsjanxbiehgognkdakfmtk HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:25 +0000] "PUT /devstoreaccount1/cont/zglnanppvsdqbbyhyuyljwrqknfhyhoe HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:26 +0000] "PUT /devstoreaccount1/cont/hraafjabxlzhwygstnqjaicqknnsbtta HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:26 +0000] "PUT /devstoreaccount1/cont/luqepqapfltevnvrmnvjovkinomwcuik HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:26 +0000] "PUT /devstoreaccount1/cont/herzbnpqgwggdbjguepgdbvqcdhqhbej HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:26 +0000] "PUT /devstoreaccount1/cont/lbkwhxvfragltaepvtaasxyxllvxafdn HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:26 +0000] "PUT /devstoreaccount1/cont/zhnodtjdayjclpddxdjduqyfingdzdbk HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:26 +0000] "PUT /devstoreaccount1/cont/wvnkbjdqttctqmfnumcskfsqkowyorix HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:26 +0000] "PUT /devstoreaccount1/cont/uuuyjhudsnpoqbvpqjwhrhlwqwjswhgy HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:26 +0000] "PUT /devstoreaccount1/cont/zvtihmgjxyhqrlxtjlzwrnuekmnvylvj HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:26 +0000] "PUT /devstoreaccount1/cont/worgddscbokcwwwswxdncpmqnzosxann HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:26 +0000] "PUT /devstoreaccount1/cont/itbskeutikvfidexnkgatfascvjbatfm HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:27 +0000] "GET /devstoreaccount1/cont/duenetumoscppglhzsmhvzljkulvttbk HTTP/1.1" 206 80 127.0.0.1 - - [09/Oct/2025:15:41:27 +0000] "GET /devstoreaccount1/cont/peewsrusyrhxciexiogszpfwcqrwwiik HTTP/1.1" 206 746 127.0.0.1 - - [09/Oct/2025:15:41:27 +0000] "GET /devstoreaccount1/cont/eictqsqafkmuvvhszkhycecbdsvrrwpz HTTP/1.1" 206 746 127.0.0.1 - - [09/Oct/2025:15:41:27 +0000] "PUT /devstoreaccount1/cont/zwzyjbodzlzlhxftdezadjorlkhpekkh HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:27 +0000] "PUT /devstoreaccount1/cont/tuiqcmnztsrurhjcttlucduzmvrspeuk HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:27 +0000] "PUT /devstoreaccount1/cont/oymohozsuichgtaqweqdgborawptaxge HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:27 +0000] "PUT /devstoreaccount1/cont/nlmfikwxkgstxonybpdkixcshocsumwb HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:27 +0000] "PUT /devstoreaccount1/cont/hnayrftcgoultklzloobljlknzjpzapb HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:27 +0000] "PUT /devstoreaccount1/cont/edetpmyyrlwjewvwwtufgnvtqlsfjbmd HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:27 +0000] "PUT /devstoreaccount1/cont/warwpelbltvzmxnnxevkfhfbyrzsaslc HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:27 +0000] "PUT /devstoreaccount1/cont/homiijzqlfnpfuiwsrxnsrplggdjoosl HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:27 +0000] "PUT /devstoreaccount1/cont/txwulkackmecgkribpunxjbwgijhizat HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:28 +0000] "PUT /devstoreaccount1/cont/qogrwzhvbqfvuzejwuocisgjbaoguufh HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:28 +0000] "PUT /devstoreaccount1/cont/iieuwhfxmmspgpndeieygstxfmegpsro HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:28 +0000] "PUT /devstoreaccount1/cont/mvufdzlqbjyyizwdpbqbfshoteepwrie HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:28 +0000] "PUT /devstoreaccount1/cont/sqhyumhvbcmtyeqknasmucoujpdabxtz HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:28 +0000] "PUT /devstoreaccount1/cont/kpozrfeexzcjdmomvtxihxwqykayvrcu HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:28 +0000] "PUT /devstoreaccount1/cont/mxeojlerdeuawgpfhiskeiejrqpkmfxy HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:28 +0000] "PUT /devstoreaccount1/cont/udfqeyexndzvfzplsktnzscbcawrgkgg HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:28 +0000] "PUT /devstoreaccount1/cont/mkfvccsekaimpltmnhtkugtilaybvvus HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:28 +0000] "PUT /devstoreaccount1/cont/lhrrobbljeodluvhtapjsvsbgxxoioui HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:28 +0000] "PUT /devstoreaccount1/cont/kmesxdtzvvepucmzmgmptwjnwngtlzre HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:28 +0000] "PUT /devstoreaccount1/cont/cafyrhpnhlwuwwndqjkhzvfmbhsglaqg HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:28 +0000] "PUT /devstoreaccount1/cont/gmikrnaucirciugilesnbbwmyaovpmky HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/dabjehpxzschewbmbzynqukjofwyjtso HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/czhujagtsmqjbywzpitbguuyrkrrhjwn HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/mhsnafuojpdlsyfgtkfyypubwfkawjir HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/wtblxvtjzxwjvjswbrsuesaugqdkwblr HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/ufjostkajexhsdnxpkrcbmsmgjwwoyfn HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/dryssjlyzcyaoqhpjrkuusvhgrgmkgkh HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/sliadswovgvzklcnuulxjrttgxwezlqw HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/isktbauidiiwzissozoxwzoduprkruwm HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/ceyklbtcamtzxbagwcxgfnhtubfjhbnw HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/vgegqrhkymfowoaminlddeiznyoebefu HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/zdeieedmclexkvfnwkpzdxsykpbsioha HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/vedsaqkvjdgkdrfvteiqsnyxfxkypkac HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/edqqehwcovwifxgzzdcnzwtimwwtoovq HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/gnlmfrdoirexulglfauidpqkbvvbtyng HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/fuzczibkudazeivzdquqbfvksiboljqw HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/sgcolfzfgwvdkanowsvuggopnnztehts HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/agkdgujpouvndsdbpnldqxyxfgfhmpnr HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/hpylovjfqaypkaswnlseaomyinciwsmy HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/ftsqsfkffqoyewthlesdhznmwyhtvvet HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/ovwwxlafftioqzlvcvqkahhgfvtsvtvo HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/ytcunzonmqsndnbcvoxtehzwostbnwwg HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/fjylpaqghwacwcsjtcjbyyugmpuazimj HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/jgwbykmktbyjmkqjhlqjxeuyycqjzxvo HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/tnwywhlmfldtckxnxrhwqysnthsllbnd HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/dfphgkhjqbsemlffyybpmnetwemgwnje HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:29 +0000] "PUT /devstoreaccount1/cont/ernchoffzfutcpdzaaunjfvuijmoykuj HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:30 +0000] "PUT /devstoreaccount1/cont/cvqnkliitqphiigbzwbxuelccvtlewuk HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:30 +0000] "PUT /devstoreaccount1/cont/rjkjvcspfcmikjcmnocazizlbwiuzjpp HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:30 +0000] "PUT /devstoreaccount1/cont/drjtczpusmmxbtcsqhkmkyzcqxezzkvo HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:30 +0000] "PUT /devstoreaccount1/cont/akpoomkurhgvitndktmykqobwawqynfk HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:30 +0000] "PUT /devstoreaccount1/cont/lvreovrpnqxnffjosslmboxmayefmnhb HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:30 +0000] "PUT /devstoreaccount1/cont/lsilgdxthvxefgytrgygpjryteneiegk HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:30 +0000] "PUT /devstoreaccount1/cont/aiwcqetxfjrvkoetqaxypmvwpqnntiib HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:30 +0000] "PUT /devstoreaccount1/cont/lrgoicswwlltadjlyjuvwgzpdjdkyvsl HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:30 +0000] "PUT /devstoreaccount1/cont/olwgxwhmhtbsrcjhnucczdmeqxryvpkc HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:30 +0000] "PUT /devstoreaccount1/cont/tnoqkdaisbojfygdlawzhehbhlsrirup HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:30 +0000] "PUT /devstoreaccount1/cont/ncagydcnytjfxumtqyefpojjkgemvkek HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:30 +0000] "PUT /devstoreaccount1/cont/zzulrqnknwsfrlesveygufehesbkspjg HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:30 +0000] "PUT /devstoreaccount1/cont/ukueyrmplagzqrsocvwqgkolubtsibbg HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:30 +0000] "PUT /devstoreaccount1/cont/qprulslrvylzzofgpjkoquqasawixprp HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:30 +0000] "PUT /devstoreaccount1/cont/peglzkiuitoftiqmoafeqljszhpdzvmy HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:30 +0000] "PUT /devstoreaccount1/cont/txbkzzqgqfzkyrsnqwixvzijdvttvibs HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:30 +0000] "PUT /devstoreaccount1/cont/sbggieueyixdhugbcrmzhcqzivofaikv HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:30 +0000] "PUT /devstoreaccount1/cont/kdazddxjtfnwiwkxjykjovubfvpafugm HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:30 +0000] "PUT /devstoreaccount1/cont/celstofdggcdomegnxsxknuimzbjyobk HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:30 +0000] "PUT /devstoreaccount1/cont/jnfuuhhjthqmmwcbhrviyldzrtkiuvqf HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:32 +0000] "PUT /devstoreaccount1/cont/rkcpsacpzjmovpjxxdvgpdbzolnolevv HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:32 +0000] "PUT /devstoreaccount1/cont/obuvqekyiphlwzzmbpnhhnaqhtpgzvdu HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:32 +0000] "PUT /devstoreaccount1/cont/zyvgzabhpnkopwmsapqxwtydkmqbqhjn HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:32 +0000] "PUT /devstoreaccount1/cont/zuhexvvpkrvmpffonrtwqifpozgkdptl HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:32 +0000] "PUT /devstoreaccount1/cont/rfqxpeickmyenvedzilyfuzcvxbmsgql HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:32 +0000] "PUT /devstoreaccount1/cont/ogtlnkzsqcynpzhpclbskeieepuggyxx HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:32 +0000] "PUT /devstoreaccount1/cont/rulsdmaebafsopflfwcmugkieuwarnbx HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:32 +0000] "PUT /devstoreaccount1/cont/syhhpemmimwquxoyrcuattlpbcvporoc HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:32 +0000] "PUT /devstoreaccount1/cont/qobvlvgdujodjaexdcvedkfqwgkexjzj HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:32 +0000] "PUT /devstoreaccount1/cont/fcupukeypyilqeptwydkihgxlthryqnf HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/hwcdnkdohhztpyuepbfcwimsppeuibbx HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/wfqcgwquzigpoayghaluolqjstxdybiq HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/jrbhhtyzopedykpqdjjrjvycassmrobs HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/peewsrusyrhxciexiogszpfwcqrwwiik HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/hhnwfvtqdhbbswoyqwvzmysvpsfyembp HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/ipssncguhuolzujnlrxlfmudgqzbascc HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/djzmjnihdqatyddhckttxqrgorwhjrqz HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/fpfrjqltravnddsrlllpypqmcsviqjcm HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/homiijzqlfnpfuiwsrxnsrplggdjoosl HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/hnayrftcgoultklzloobljlknzjpzapb HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/nlmfikwxkgstxonybpdkixcshocsumwb HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/zwzyjbodzlzlhxftdezadjorlkhpekkh HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/tuiqcmnztsrurhjcttlucduzmvrspeuk HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/oymohozsuichgtaqweqdgborawptaxge HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/warwpelbltvzmxnnxevkfhfbyrzsaslc HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/edetpmyyrlwjewvwwtufgnvtqlsfjbmd HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/mkfvccsekaimpltmnhtkugtilaybvvus HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/kpozrfeexzcjdmomvtxihxwqykayvrcu HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/sqhyumhvbcmtyeqknasmucoujpdabxtz HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/qogrwzhvbqfvuzejwuocisgjbaoguufh HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/iieuwhfxmmspgpndeieygstxfmegpsro HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/mvufdzlqbjyyizwdpbqbfshoteepwrie HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/udfqeyexndzvfzplsktnzscbcawrgkgg HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/mxeojlerdeuawgpfhiskeiejrqpkmfxy HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/fcupukeypyilqeptwydkihgxlthryqnf HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/rkcpsacpzjmovpjxxdvgpdbzolnolevv HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/ogtlnkzsqcynpzhpclbskeieepuggyxx HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/obuvqekyiphlwzzmbpnhhnaqhtpgzvdu HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/rulsdmaebafsopflfwcmugkieuwarnbx HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/rfqxpeickmyenvedzilyfuzcvxbmsgql HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/zyvgzabhpnkopwmsapqxwtydkmqbqhjn HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/zuhexvvpkrvmpffonrtwqifpozgkdptl HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/qobvlvgdujodjaexdcvedkfqwgkexjzj HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/syhhpemmimwquxoyrcuattlpbcvporoc HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/esefuzvubetolgzvwfpwanbypycsyyas HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/xzisehqqpdqijtoyhlxgdnirndgqhnhb HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/wfsyhcpihkhhhpcpqpmtjylvrcqrxonc HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/acngmrpvvqgmtiamgmpygfyefccsayve HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/bebwkhsgrhsvuuhyaeupdxihgjprxvrr HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/dklakzrfoqebwfwknadrwzstcbaeaiee HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/fyeiynhwuwuddmuyskxukmnfwvdahumh HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/wiztnsfqrwuaatwjcuwqwtdjqmaauubh HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/eumiodxehqohsrfptjftiviyowyrzhxw HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/henopvpspvshzxixnnfpsatzustsgpbw HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/aikmkadwgcqpcbfatvjhrornhiemswxs HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/eictqsqafkmuvvhszkhycecbdsvrrwpz HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/duenetumoscppglhzsmhvzljkulvttbk HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/uxhciiqosnrnbwguzydvorbpmqchspcb HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/ewiyccebbictfscsafhagnirmhtxauev HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/qozqicuxkvnvjukkuhlfrhsppichewnb HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/luqepqapfltevnvrmnvjovkinomwcuik HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/rbnpnpjucjlsjanxbiehgognkdakfmtk HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/rotnzfjoqprxskidmfbjcajspykwqeul HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/ozohnpbgwizuqcgpyatwnknrhtymfbct HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/flebyvqxsiaorxhonuoyvlujyktgorgj HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/glezmngcaygeumdvbvglxrdjfnbozekh HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/hraafjabxlzhwygstnqjaicqknnsbtta HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/zglnanppvsdqbbyhyuyljwrqknfhyhoe HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/itbskeutikvfidexnkgatfascvjbatfm HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/uuuyjhudsnpoqbvpqjwhrhlwqwjswhgy HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/wvnkbjdqttctqmfnumcskfsqkowyorix HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/herzbnpqgwggdbjguepgdbvqcdhqhbej HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/lbkwhxvfragltaepvtaasxyxllvxafdn HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/zhnodtjdayjclpddxdjduqyfingdzdbk HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/worgddscbokcwwwswxdncpmqnzosxann HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/zvtihmgjxyhqrlxtjlzwrnuekmnvylvj HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/dryssjlyzcyaoqhpjrkuusvhgrgmkgkh HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/lhrrobbljeodluvhtapjsvsbgxxoioui HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/czhujagtsmqjbywzpitbguuyrkrrhjwn HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/kmesxdtzvvepucmzmgmptwjnwngtlzre HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/mhsnafuojpdlsyfgtkfyypubwfkawjir HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/dabjehpxzschewbmbzynqukjofwyjtso HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/cafyrhpnhlwuwwndqjkhzvfmbhsglaqg HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/gmikrnaucirciugilesnbbwmyaovpmky HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/ufjostkajexhsdnxpkrcbmsmgjwwoyfn HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/wtblxvtjzxwjvjswbrsuesaugqdkwblr HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/sgcolfzfgwvdkanowsvuggopnnztehts HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/sliadswovgvzklcnuulxjrttgxwezlqw HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/vedsaqkvjdgkdrfvteiqsnyxfxkypkac HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/isktbauidiiwzissozoxwzoduprkruwm HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/edqqehwcovwifxgzzdcnzwtimwwtoovq HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/zdeieedmclexkvfnwkpzdxsykpbsioha HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/ceyklbtcamtzxbagwcxgfnhtubfjhbnw HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/vgegqrhkymfowoaminlddeiznyoebefu HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/fuzczibkudazeivzdquqbfvksiboljqw HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/gnlmfrdoirexulglfauidpqkbvvbtyng HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/ernchoffzfutcpdzaaunjfvuijmoykuj HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/agkdgujpouvndsdbpnldqxyxfgfhmpnr HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/fjylpaqghwacwcsjtcjbyyugmpuazimj HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/hpylovjfqaypkaswnlseaomyinciwsmy HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/jgwbykmktbyjmkqjhlqjxeuyycqjzxvo HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/ytcunzonmqsndnbcvoxtehzwostbnwwg HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/ftsqsfkffqoyewthlesdhznmwyhtvvet HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/ovwwxlafftioqzlvcvqkahhgfvtsvtvo HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/dfphgkhjqbsemlffyybpmnetwemgwnje HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/tnwywhlmfldtckxnxrhwqysnthsllbnd HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/tnoqkdaisbojfygdlawzhehbhlsrirup HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/cvqnkliitqphiigbzwbxuelccvtlewuk HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/lsilgdxthvxefgytrgygpjryteneiegk HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/rjkjvcspfcmikjcmnocazizlbwiuzjpp HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/aiwcqetxfjrvkoetqaxypmvwpqnntiib HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/lvreovrpnqxnffjosslmboxmayefmnhb HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/drjtczpusmmxbtcsqhkmkyzcqxezzkvo HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/akpoomkurhgvitndktmykqobwawqynfk HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/olwgxwhmhtbsrcjhnucczdmeqxryvpkc HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/lrgoicswwlltadjlyjuvwgzpdjdkyvsl HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/jnfuuhhjthqmmwcbhrviyldzrtkiuvqf HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/ncagydcnytjfxumtqyefpojjkgemvkek HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/txbkzzqgqfzkyrsnqwixvzijdvttvibs HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/zzulrqnknwsfrlesveygufehesbkspjg HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/sbggieueyixdhugbcrmzhcqzivofaikv HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/peglzkiuitoftiqmoafeqljszhpdzvmy HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/ukueyrmplagzqrsocvwqgkolubtsibbg HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/qprulslrvylzzofgpjkoquqasawixprp HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/celstofdggcdomegnxsxknuimzbjyobk HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/kdazddxjtfnwiwkxjykjovubfvpafugm HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/ohhravsccsmjbyndvwdeakfmkspaxfxl HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:33 +0000] "DELETE /devstoreaccount1/cont/txwulkackmecgkribpunxjbwgijhizat HTTP/1.1" 202 - 2025-10-09 12:41:34 02241_filesystem_cache_on_write_operations: [ OK ] 53.08 sec. 2025-10-09 12:41:34 02240_filesystem_cache_bypass_cache_threshold: [ OK ] 0.74 sec. 2025-10-09 12:41:35 02240_filesystem_query_cache: [ OK ] 0.83 sec. 127.0.0.1 - - [09/Oct/2025:15:41:50 +0000] "PUT /devstoreaccount1/cont/urxkqgwawlzkbpirdmtlrftiwirokeeb HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:51 +0000] "PUT /devstoreaccount1/cont/peqqaxtdkzjrwisrcaniqojlabqnpndc HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:51 +0000] "PUT /devstoreaccount1/cont/qbshrzautfnpssbdfovkicnalggijlea HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:51 +0000] "PUT /devstoreaccount1/cont/oiwtibfvykdarfnnfnsvakyhqhippnsl HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:51 +0000] "PUT /devstoreaccount1/cont/xsnsifrvcotbdzghkqonvyzdqyuqyzpm HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:51 +0000] "PUT /devstoreaccount1/cont/rehtdivfmqhusdhrdmpfnhherrjkcgwq HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:51 +0000] "PUT /devstoreaccount1/cont/ndyxqrrgfycbyoxzheclmlyqjetyqrra HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:51 +0000] "PUT /devstoreaccount1/cont/aapwwldwtvxwhchmcsbnduhxfemmowhi HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:51 +0000] "PUT /devstoreaccount1/cont/nnjtppppxfpmhnxbyvtjhpertwlcjlpf HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:51 +0000] "PUT /devstoreaccount1/cont/hpidutwgtgakaepxcfybgrhltntcmngb HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:41:51 +0000] "GET /devstoreaccount1/cont/qbshrzautfnpssbdfovkicnalggijlea HTTP/1.1" 206 80 127.0.0.1 - - [09/Oct/2025:15:41:51 +0000] "GET /devstoreaccount1/cont/peqqaxtdkzjrwisrcaniqojlabqnpndc HTTP/1.1" 206 746 127.0.0.1 - - [09/Oct/2025:15:41:54 +0000] "GET /devstoreaccount1/cont/qbshrzautfnpssbdfovkicnalggijlea HTTP/1.1" 206 80 127.0.0.1 - - [09/Oct/2025:15:41:54 +0000] "GET /devstoreaccount1/cont/peqqaxtdkzjrwisrcaniqojlabqnpndc HTTP/1.1" 206 746 127.0.0.1 - - [09/Oct/2025:15:41:55 +0000] "DELETE /devstoreaccount1/cont/hpidutwgtgakaepxcfybgrhltntcmngb HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:55 +0000] "DELETE /devstoreaccount1/cont/ndyxqrrgfycbyoxzheclmlyqjetyqrra HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:55 +0000] "DELETE /devstoreaccount1/cont/xsnsifrvcotbdzghkqonvyzdqyuqyzpm HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:55 +0000] "DELETE /devstoreaccount1/cont/peqqaxtdkzjrwisrcaniqojlabqnpndc HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:55 +0000] "DELETE /devstoreaccount1/cont/qbshrzautfnpssbdfovkicnalggijlea HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:55 +0000] "DELETE /devstoreaccount1/cont/oiwtibfvykdarfnnfnsvakyhqhippnsl HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:55 +0000] "DELETE /devstoreaccount1/cont/rehtdivfmqhusdhrdmpfnhherrjkcgwq HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:55 +0000] "DELETE /devstoreaccount1/cont/nnjtppppxfpmhnxbyvtjhpertwlcjlpf HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:55 +0000] "DELETE /devstoreaccount1/cont/aapwwldwtvxwhchmcsbnduhxfemmowhi HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:41:55 +0000] "DELETE /devstoreaccount1/cont/urxkqgwawlzkbpirdmtlrftiwirokeeb HTTP/1.1" 202 - 2025-10-09 12:41:55 02240_system_filesystem_cache_table: [ OK ] 19.65 sec. 2025-10-09 12:41:55 02232_dist_insert_send_logs_level_hung: [ SKIPPED ] 0.00 sec. 2025-10-09 12:41:55 Reason: disabled 2025-10-09 12:41:59 02227_test_create_empty_sqlite_db: [ OK ] 3.85 sec. 127.0.0.1 - - [09/Oct/2025:15:42:17 +0000] "PUT /devstoreaccount1/cont/xanvmttjdrinvhocvxyzhxveduecmqaa HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:17 +0000] "PUT /devstoreaccount1/cont/fywsxlkxelxtjabteumvtugkmtkbuvpn HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:17 +0000] "PUT /devstoreaccount1/cont/vinplaxxjbtjpphwxjimgjolobjbtxex HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:17 +0000] "PUT /devstoreaccount1/cont/vlxwocklqyedkswqbicdsijarputpxbe HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:17 +0000] "PUT /devstoreaccount1/cont/pgmptkbchbvmbafyihjmntcsrzkibtps HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:17 +0000] "PUT /devstoreaccount1/cont/tlgucqovszxktkzcbacsxnpwhodujlsx HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:18 +0000] "PUT /devstoreaccount1/cont/dxnyflrvracnhxmkgtakkhrxesqwjieh HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:18 +0000] "PUT /devstoreaccount1/cont/bagvltxaytaqihlkxnawbiwowzutasxq HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:18 +0000] "PUT /devstoreaccount1/cont/dcrspkfgvcehbisqyamajenknirwyelc HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:18 +0000] "PUT /devstoreaccount1/cont/ubykwtabspvacnmtwhehzphfwojxbyee HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:18 +0000] "GET /devstoreaccount1/cont/vinplaxxjbtjpphwxjimgjolobjbtxex HTTP/1.1" 206 62 127.0.0.1 - - [09/Oct/2025:15:42:18 +0000] "GET /devstoreaccount1/cont/fywsxlkxelxtjabteumvtugkmtkbuvpn HTTP/1.1" 206 100325 127.0.0.1 - - [09/Oct/2025:15:42:24 +0000] "PUT /devstoreaccount1/cont/xzsxeufodrlidxhfczykinncaadayenn HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:24 +0000] "PUT /devstoreaccount1/cont/wvitrfzmdvryphmqndzwhheozaszumti HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:24 +0000] "PUT /devstoreaccount1/cont/fvsxkkrntypzdyqnuemwlrbbaydrnfxu HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:24 +0000] "PUT /devstoreaccount1/cont/jwejzutqefikzrocoxohmsqfhpgpcmrq HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:24 +0000] "PUT /devstoreaccount1/cont/vrzxpbhugjbmklfoygmhgbrnyvikyoft HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:24 +0000] "DELETE /devstoreaccount1/cont/ubykwtabspvacnmtwhehzphfwojxbyee HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:42:24 +0000] "DELETE /devstoreaccount1/cont/dxnyflrvracnhxmkgtakkhrxesqwjieh HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:42:24 +0000] "DELETE /devstoreaccount1/cont/pgmptkbchbvmbafyihjmntcsrzkibtps HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:42:24 +0000] "DELETE /devstoreaccount1/cont/vinplaxxjbtjpphwxjimgjolobjbtxex HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:42:24 +0000] "DELETE /devstoreaccount1/cont/fywsxlkxelxtjabteumvtugkmtkbuvpn HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:42:24 +0000] "DELETE /devstoreaccount1/cont/vlxwocklqyedkswqbicdsijarputpxbe HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:42:24 +0000] "DELETE /devstoreaccount1/cont/tlgucqovszxktkzcbacsxnpwhodujlsx HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:42:24 +0000] "DELETE /devstoreaccount1/cont/dcrspkfgvcehbisqyamajenknirwyelc HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:42:24 +0000] "DELETE /devstoreaccount1/cont/bagvltxaytaqihlkxnawbiwowzutasxq HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:42:24 +0000] "PUT /devstoreaccount1/cont/fzsvcelbluftjzhlpkvwzwhnruftsrjd HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:24 +0000] "PUT /devstoreaccount1/cont/ftvdavjabzbuntndutmelyrcdieiwgqd HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:24 +0000] "PUT /devstoreaccount1/cont/pqjfonfgozclldskkkdluwytsweguoyk HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:24 +0000] "PUT /devstoreaccount1/cont/fxjjpqzhvjqpgtuodsbsrajyxumzdvvj HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:24 +0000] "PUT /devstoreaccount1/cont/vffmsoijhadcnvgheemrqzzpylcpjbgf HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:24 +0000] "PUT /devstoreaccount1/cont/qdmacodhvuomumolpnvhsgqzsvmncyrf HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:24 +0000] "PUT /devstoreaccount1/cont/mpeqpaylpdoetzccauvqpjnffcwxqizt HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:24 +0000] "PUT /devstoreaccount1/cont/dnlkwkjodlcbmlipdeiquddfazjarjqx HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:24 +0000] "PUT /devstoreaccount1/cont/biggcrbyebnwsdivnpwqqpbdcoxjitrp HTTP/1.1" 201 - 127.0.0.1 - - [09/Oct/2025:15:42:25 +0000] "DELETE /devstoreaccount1/cont/vrzxpbhugjbmklfoygmhgbrnyvikyoft HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:42:25 +0000] "DELETE /devstoreaccount1/cont/wvitrfzmdvryphmqndzwhheozaszumti HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:42:25 +0000] "DELETE /devstoreaccount1/cont/xzsxeufodrlidxhfczykinncaadayenn HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:42:25 +0000] "DELETE /devstoreaccount1/cont/oxufmhssxljrjhskpqhxohjeollfvlga HTTP/1.1" 404 - 127.0.0.1 - - [09/Oct/2025:15:42:25 +0000] "DELETE /devstoreaccount1/cont/radwqsxxgcsalxzsduvlzrfwljsiosuc HTTP/1.1" 404 - 127.0.0.1 - - [09/Oct/2025:15:42:25 +0000] "DELETE /devstoreaccount1/cont/nzhajrqlorskmecxjkvssntqnyrpmipo HTTP/1.1" 404 - 127.0.0.1 - - [09/Oct/2025:15:42:25 +0000] "DELETE /devstoreaccount1/cont/jwejzutqefikzrocoxohmsqfhpgpcmrq HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:42:25 +0000] "DELETE /devstoreaccount1/cont/fvsxkkrntypzdyqnuemwlrbbaydrnfxu HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:42:25 +0000] "DELETE /devstoreaccount1/cont/biggcrbyebnwsdivnpwqqpbdcoxjitrp HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:42:25 +0000] "DELETE /devstoreaccount1/cont/qdmacodhvuomumolpnvhsgqzsvmncyrf HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:42:25 +0000] "DELETE /devstoreaccount1/cont/fxjjpqzhvjqpgtuodsbsrajyxumzdvvj HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:42:25 +0000] "DELETE /devstoreaccount1/cont/ftvdavjabzbuntndutmelyrcdieiwgqd HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:42:25 +0000] "DELETE /devstoreaccount1/cont/fzsvcelbluftjzhlpkvwzwhnruftsrjd HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:42:25 +0000] "DELETE /devstoreaccount1/cont/pqjfonfgozclldskkkdluwytsweguoyk HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:42:25 +0000] "DELETE /devstoreaccount1/cont/vffmsoijhadcnvgheemrqzzpylcpjbgf HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:42:25 +0000] "DELETE /devstoreaccount1/cont/dnlkwkjodlcbmlipdeiquddfazjarjqx HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:42:25 +0000] "DELETE /devstoreaccount1/cont/mpeqpaylpdoetzccauvqpjnffcwxqizt HTTP/1.1" 202 - 127.0.0.1 - - [09/Oct/2025:15:42:25 +0000] "DELETE /devstoreaccount1/cont/xanvmttjdrinvhocvxyzhxveduecmqaa HTTP/1.1" 202 - 2025-10-09 12:42:25 02226_filesystem_cache_profile_events: [ OK ] 25.82 sec. 2025-10-09 12:42:27 02225_unwinder_dwarf_version: [ OK ] 2.29 sec. 2025-10-09 12:42:36 02222_create_table_without_columns_metadata: [ OK ] 8.67 sec. 2025-10-09 12:42:42 02207_allow_plaintext_and_no_password: [ OK ] 6.25 sec. 2025-10-09 12:42:47 02185_values_schema_inference: [ OK ] 5.05 sec. 2025-10-09 12:42:50 02184_ipv6_parsing: [ OK ] 3.14 sec. 2025-10-09 12:42:53 02182_json_each_row_schema_inference: [ OK ] 2.54 sec. 2025-10-09 12:42:55 02179_dict_reload_on_cluster: [ OK ] 1.49 sec. 2025-10-09 12:42:56 02177_temporary_table_current_database_http_session: [ OK ] 1.79 sec. 2025-10-09 12:42:57 02168_avro_bug: [ OK ] 0.84 sec. 2025-10-09 12:43:01 02166_arrow_dictionary_inference: [ OK ] 3.25 sec. 2025-10-09 12:43:02 02155_multiple_inserts_for_formats_with_suffix: [ OK ] 1.69 sec. 2025-10-09 12:43:03 02148_sql_user_defined_function_subquery: [ OK ] 0.89 sec. 2025-10-09 12:43:04 02126_identity_user_defined_function: [ OK ] 0.68 sec. 2025-10-09 12:43:05 02125_recursive_sql_user_defined_functions: [ OK ] 0.84 sec. 2025-10-09 12:43:05 02125_many_mutations_2: [ SKIPPED ] 0.00 sec. 2025-10-09 12:43:05 Reason: not running for current build 2025-10-09 12:43:09 02105_table_function_file_partiotion_by: [ OK ] 4.40 sec. 2025-10-09 12:43:12 02104_json_strings_nullable_string: [ OK ] 2.74 sec. 2025-10-09 12:43:13 02103_sql_user_defined_functions_composition: [ OK ] 0.76 sec. 2025-10-09 12:43:32 02103_tsv_csv_custom_null_representation: [ OK ] 18.73 sec. 2025-10-09 12:43:33 02101_sql_user_defined_functions_drop_if_exists: [ OK ] 0.84 sec. 2025-10-09 12:43:33 02098_sql_user_defined_functions_aliases: [ OK ] 0.79 sec. 2025-10-09 12:43:34 02096_sql_user_defined_function_alias: [ OK ] 0.85 sec. 2025-10-09 12:43:36 02096_rename_atomic_hang: [ OK ] 1.39 sec. 2025-10-09 12:43:46 02051_read_settings: [ OK ] 10.15 sec. 2025-10-09 12:43:48 02028_add_default_database_for_alterquery_on_cluster: [ OK ] 1.85 sec. 2025-10-09 12:44:21 02026_storage_filelog_largefile: [ OK ] 33.57 sec. 2025-10-09 12:44:23 02025_dictionary_view_different_db: [ OK ] 1.29 sec. 2025-10-09 12:44:24 02015_column_default_dict_get_identifier: [ OK ] 1.20 sec. 2025-10-09 12:44:30 02015_global_in_threads: [ OK ] 5.83 sec. 2025-10-09 12:44:31 02011_dictionary_empty_attribute_list: [ OK ] 1.10 sec. 2025-10-09 12:44:33 01999_grant_with_replace: [ OK ] 1.70 sec. 2025-10-09 12:44:34 01948_dictionary_quoted_database_name: [ OK ] 1.14 sec. 2025-10-09 12:44:36 01915_create_or_replace_dictionary: [ OK ] 1.40 sec. 2025-10-09 12:44:38 01913_exact_rows_before_limit_full: [ OK ] 1.91 sec. 2025-10-09 12:44:39 01910_view_dictionary: [ OK ] 1.29 sec. 2025-10-09 12:44:42 01903_ssd_cache_dictionary_array_type: [ OK ] 3.00 sec. 2025-10-09 12:44:44 01902_table_function_merge_db_repr: [ OK ] 2.45 sec. 2025-10-09 12:44:46 01901_test_attach_partition_from: [ OK ] 1.89 sec. 2025-10-09 12:44:49 01889_postgresql_protocol_null_fields: [ OK ] 2.70 sec. 2025-10-09 12:44:50 01870_buffer_flush: [ OK ] 1.04 sec. 2025-10-09 12:44:51 01856_create_function: [ OK ] 1.14 sec. 2025-10-09 12:44:57 01853_dictionary_cache_duplicates: [ OK ] 5.12 sec. 2025-10-09 12:44:58 01850_dist_INSERT_preserve_error: [ OK ] 1.30 sec. 2025-10-09 12:44:59 01837_database_memory_ddl_dictionaries: [ OK ] 1.01 sec. 2025-10-09 12:45:00 01821_table_comment: [ OK ] 1.40 sec. 2025-10-09 12:45:03 01785_dictionary_element_count: [ OK ] 2.05 sec. 2025-10-09 12:45:05 01778_hierarchical_dictionaries: [ OK ] 2.45 sec. 2025-10-09 12:45:08 01754_direct_dictionary_complex_key: [ OK ] 3.01 sec. 2025-10-09 12:45:11 01753_direct_dictionary_simple_key: [ OK ] 3.26 sec. 2025-10-09 12:45:13 01747_executable_pool_dictionary_implicit_key: [ OK ] 1.04 sec. 2025-10-09 12:45:14 01746_executable_pool_dictionary: [ OK ] 0.94 sec. 2025-10-09 12:45:19 01737_clickhouse_server_wait_server_pool_long: [ OK ] 5.16 sec. 2025-10-09 12:45:26 01722_long_brotli_http_compression_json_format: [ OK ] 6.87 sec. 2025-10-09 12:45:27 01721_engine_file_truncate_on_insert: [ OK ] 0.99 sec. 2025-10-09 12:45:27 01710_projection_vertical_merges: [ SKIPPED ] 0.00 sec. 2025-10-09 12:45:27 Reason: not running for current build 2025-10-09 12:45:29 01681_cache_dictionary_simple_key: [ OK ] 2.44 sec. API: SYSTEM.config Time: 15:45:30 UTC 10/09/2025 DeploymentID: c82d706d-e6b4-48c0-a1d0-74fabb6e2759 Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": context deadline exceeded', please check your endpoint configuration' (*fmt.wrapError) 4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf() 3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf() 2: cmd/logging.go:132:cmd.configLogOnceConsoleIf() 1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor() 2025-10-09 12:45:31 01676_dictget_in_default_expression: [ OK ] 1.59 sec. 2025-10-09 12:45:32 01670_dictionary_create_key_expression: [ OK ] 1.13 sec. 2025-10-09 12:45:33 01646_system_restart_replicas_smoke: [ OK ] 0.99 sec. 2025-10-09 12:45:38 01643_replicated_merge_tree_fsync_smoke: [ OK ] 5.16 sec. 2025-10-09 12:45:40 01615_random_one_shard_insertion: [ OK ] 1.74 sec. 2025-10-09 12:45:41 01603_rename_overwrite_bug: [ OK ] 1.29 sec. 2025-10-09 12:46:45 01600_detach_permanently: [ OK ] 63.64 sec. 2025-10-09 12:47:50 01593_concurrent_alter_mutations_kill_many_replicas_long: [ OK ] 64.91 sec. 2025-10-09 12:47:51 01575_disable_detach_table_of_dictionary: [ OK ] 0.68 sec. 2025-10-09 12:47:52 01530_drop_database_atomic_sync: [ OK ] 1.54 sec. 2025-10-09 12:47:55 01527_clickhouse_local_optimize: [ OK ] 2.18 sec. 2025-10-09 12:47:55 01526_complex_key_dict_direct_layout: [ OK ] 0.78 sec. 2025-10-09 12:47:59 01524_do_not_merge_across_partitions_select_final: [ OK ] 3.44 sec. 2025-10-09 12:48:00 01517_drop_mv_with_inner_table: [ OK ] 0.98 sec. 2025-10-09 12:48:04 01507_clickhouse_server_start_with_embedded_config: [ OK ] 3.94 sec. 2025-10-09 12:48:07 01501_cache_dictionary_all_fields: [ OK ] 3.54 sec. 2025-10-09 12:48:09 01474_executable_dictionary: [ OK ] 1.98 sec. 2025-10-09 12:48:11 01471_calculate_ttl_during_merge: [ OK ] 1.08 sec. 2025-10-09 12:48:41 01459_manual_write_to_replicas_quorum_detach_attach: [ OK ] 30.47 sec. 2025-10-09 12:50:03 01459_manual_write_to_replicas: [ OK ] 81.68 sec. 2025-10-09 12:50:04 01457_create_as_table_function_structure: [ OK ] 0.93 sec. 2025-10-09 12:50:05 01455_rank_correlation_spearman: [ OK ] 0.88 sec. 2025-10-09 12:50:27 01454_storagememory_data_race_challenge: [ OK ] 22.74 sec. 2025-10-09 12:50:35 01417_freeze_partition_verbose_zookeeper: [ OK ] 7.40 sec. 2025-10-09 12:50:48 01417_freeze_partition_verbose: [ OK ] 12.97 sec. 2025-10-09 12:51:35 01414_mutations_and_errors_zookeeper: [ OK ] 47.42 sec. 2025-10-09 12:51:41 01410_nullable_key_more_tests: [ OK ] 5.89 sec. 2025-10-09 12:51:51 01375_storage_file_tsv_csv_with_names_write_prefix: [ OK ] 9.41 sec. 2025-10-09 12:51:55 01360_materialized_view_with_join_on_query_log: [ OK ] 4.04 sec. 2025-10-09 12:51:57 01356_view_threads: [ OK ] 1.84 sec. 2025-10-09 12:52:09 01320_create_sync_race_condition_zookeeper: [ OK ] 12.46 sec. 2025-10-09 12:52:20 01307_multiple_leaders_zookeeper: [ OK ] 11.11 sec. 2025-10-09 12:52:33 01305_replica_create_drop_zookeeper: [ OK ] 12.56 sec. 2025-10-09 12:53:05 01301_aggregate_state_exception_memory_leak: [ OK ] 32.02 sec. 2025-10-09 12:53:08 01297_create_quota: [ OK ] 2.44 sec. 2025-10-09 12:53:09 01295_create_row_policy: [ OK ] 1.13 sec. 2025-10-09 12:53:10 01294_system_distributed_on_cluster: [ OK ] 0.83 sec. 2025-10-09 12:53:11 01294_create_settings_profile: [ OK ] 1.53 sec. 2025-10-09 12:53:12 01293_system_distribution_queue: [ OK ] 0.88 sec. 2025-10-09 12:53:13 01281_unsucceeded_insert_select_queries_counter: [ OK ] 1.04 sec. 2025-10-09 12:53:13 01281_group_by_limit_memory_tracking: [ SKIPPED ] 0.00 sec. 2025-10-09 12:53:13 Reason: not running for current build 2025-10-09 12:53:19 01280_ssd_complex_key_dictionary: [ OK ] 6.10 sec. 2025-10-09 12:54:24 01275_parallel_mv: [ OK ] 64.45 sec. 2025-10-09 12:54:25 01251_dict_is_in_infinite_loop: [ OK ] 1.63 sec. 2025-10-09 12:54:26 01225_show_create_table_from_dictionary: [ OK ] 0.53 sec. 2025-10-09 12:55:07 01192_rename_database_zookeeper: [ OK ] 41.44 sec. 2025-10-09 12:55:08 01164_alter_memory_database: [ OK ] 0.78 sec. 2025-10-09 12:55:11 01155_rename_move_materialized_view: [ OK ] 2.64 sec. 2025-10-09 12:56:31 01154_move_partition_long: [ OK ] 80.46 sec. 2025-10-09 12:56:33 01153_attach_mv_uuid: [ OK ] 1.99 sec. 2025-10-09 12:56:36 01148_zookeeper_path_macros_unfolding: [ OK ] 2.08 sec. 2025-10-09 12:56:36 01119_weird_user_names: [ OK ] 0.78 sec. 2025-10-09 12:57:02 01111_create_drop_replicated_db_stress: [ OK ] 25.47 sec. 2025-10-09 12:57:03 01110_dictionary_layout_without_arguments: [ OK ] 0.63 sec. 2025-10-09 12:57:04 01103_distributed_product_mode_local_column_renames: [ OK ] 1.73 sec. 2025-10-09 12:57:12 01098_temporary_and_external_tables: [ OK ] 8.15 sec. 2025-10-09 12:57:16 01091_num_threads: [ OK ] 3.84 sec. 2025-10-09 12:57:19 01085_max_distributed_connections_http: [ OK ] 2.59 sec. 2025-10-09 12:58:05 01083_expressions_in_engine_arguments: [ OK ] 45.66 sec. 2025-10-09 12:58:06 01082_window_view_watch_limit: [ OK ] 1.53 sec. 2025-10-09 12:58:43 01079_parallel_alter_detach_table_zookeeper: [ OK ] 36.39 sec. 2025-10-09 12:58:52 01076_cache_dictionary_datarace_exception_ptr: [ OK ] 8.90 sec. 2025-10-09 12:58:56 01075_window_view_proc_tumble_to_now_populate: [ OK ] 4.59 sec. 2025-10-09 12:58:58 01070_materialize_ttl: [ OK ] 2.08 sec. 2025-10-09 12:59:00 01070_mutations_with_dependencies: [ OK ] 1.63 sec. 2025-10-09 12:59:03 01070_modify_ttl: [ OK ] 2.54 sec. 2025-10-09 12:59:12 01069_window_view_proc_tumble_watch: [ OK ] 8.91 sec. 2025-10-09 12:59:14 01065_window_view_event_hop_watch_bounded: [ OK ] 2.49 sec. 2025-10-09 12:59:16 01060_shutdown_table_after_detach: [ OK ] 2.39 sec. 2025-10-09 12:59:21 01055_window_view_proc_hop_to: [ OK ] 4.39 sec. 2025-10-09 12:59:26 01053_ssd_dictionary: [ OK ] 4.69 sec. 2025-10-09 12:59:32 01038_dictionary_lifetime_min_zero_sec: [ OK ] 6.65 sec. 2025-10-09 12:59:33 01036_no_superfluous_dict_reload_on_create_database: [ OK ] 0.88 sec. 2025-10-09 12:59:34 01036_no_superfluous_dict_reload_on_create_database_2: [ OK ] 1.03 sec. 2025-10-09 12:59:35 01023_materialized_view_query_context: [ OK ] 1.03 sec. 2025-10-09 12:59:50 01018_ddl_dictionaries_concurrent_requrests: [ OK ] 14.19 sec. 2025-10-09 12:59:56 01018_ddl_dictionaries_bad_queries: [ OK ] 5.89 sec. 2025-10-09 13:00:21 01014_lazy_database_concurrent_recreate_reattach_and_show_tables: [ OK ] 25.30 sec. 2025-10-09 13:00:40 01014_lazy_database_basic: [ OK ] 19.08 sec. 2025-10-09 13:00:44 01013_sync_replica_timeout_zookeeper: [ OK ] 4.19 sec. 2025-10-09 13:00:58 01007_r1r2_w_r2r1_deadlock: [ OK ] 14.07 sec. 2025-10-09 13:01:13 01004_rename_deadlock: [ OK ] 15.04 sec. 2025-10-09 13:01:15 00985_merge_stack_overflow: [ OK ] 1.43 sec. 2025-10-09 13:01:17 00971_query_id_in_logs: [ OK ] 1.83 sec. 2025-10-09 13:01:18 00963_achimbab: [ OK ] 0.98 sec. 2025-10-09 13:01:20 00950_dict_get: [ OK ] 2.53 sec. 2025-10-09 13:01:20 00877_memory_limit_for_new_delete: [ SKIPPED ] 0.00 sec. 2025-10-09 13:01:20 Reason: not running for current build 2025-10-09 13:01:52 00840_long_concurrent_select_and_drop_deadlock: [ OK ] 31.76 sec. 2025-10-09 13:01:54 00722_inner_join: [ OK ] 1.29 sec. 2025-10-09 13:01:55 00693_max_block_size_system_tables_columns: [ OK ] 1.23 sec. 2025-10-09 13:02:02 00623_truncate_table_throw_exception: [ OK ] 6.85 sec. 2025-10-09 13:02:04 00510_materizlized_view_and_deduplication_zookeeper: [ OK ] 2.03 sec. 2025-10-09 13:02:15 00463_long_sessions_in_http_interface: [ OK ] 10.86 sec. 2025-10-09 13:02:15 00332_quantile_timing_memory_leak: [ OK ] 0.68 sec. 2025-10-09 13:02:16 00309_formats_case_insensitive: [ OK ] 0.88 sec. 2025-10-09 13:02:16 00002_log_and_exception_messages_formatting: [ SKIPPED ] 0.00 sec. 2025-10-09 13:02:16 Reason: skip 2025-10-09 13:02:16 2025-10-09 13:02:16 Having 1 errors! 265 tests passed. 15 tests skipped. 2651.77 s elapsed (MainProcess). 2025-10-09 13:02:20 Won't run stateful tests because test data wasn't loaded. 2025-10-09 13:02:20 Checking the hung queries: done 2025-10-09 13:02:20 2025-10-09 13:02:20 No queries hung. 2025-10-09 13:02:20 All tests have finished. 2025-10-09 13:02:20 2025-10-09 13:02:20 Top patterns of log messages: 2025-10-09 13:02:20 2025-10-09 13:02:20 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string 2025-10-09 13:02:20 2025-10-09 13:02:20 1. 209937 0.08 9.32 MiB 0.035 1 1266 ['Trace'] 1 is disk {} eligible for search: {} 2025-10-09 13:02:20 2. 127573 0.049 24.44 MiB 0.092 1 361 ['Debug'] 0 (from {}{}{}){}{} {} (stage: {}) 2025-10-09 13:02:20 3. 127515 0.049 19.09 MiB 0.072 38794 357 ['Trace'] 1 {} Creating query context from {} context, user_id: {}, parent context user: {} 2025-10-09 13:02:20 4. 106544 0.041 2.56 MiB 0.01 1 810 ['Trace'] 0.001 Query to stage {}{} 2025-10-09 13:02:20 5. 105103 0.04 4.95 MiB 0.019 1 810 ['Trace'] 0.001 Query from stage {} to stage {}{} 2025-10-09 13:02:20 6. 103429 0.04 2.85 MiB 0.011 1 302 ['Debug'] 0 Processed in {} sec. 2025-10-09 13:02:20 7. 84027 0.032 3.67 MiB 0.014 1 1 ['Trace'] 1 Processing requests batch, size: {}, bytes: {} 2025-10-09 13:02:20 8. 70948 0.027 5.57 MiB 0.021 1 334 ['Debug'] 0 Read {} rows, {} in {} sec., {} rows/sec., {}/sec. 2025-10-09 13:02:20 9. 61080 0.023 2.00 MiB 0.008 1 1595 ['Trace'] 0 Aggregation method: {} 2025-10-09 13:02:20 10. 56418 0.022 5.02 MiB 0.019 1 1593 ['Trace'] 0 Aggregated. {} to {} rows (from {}) in {} sec. ({:.3f} rows/sec., {}/sec.) 2025-10-09 13:02:20 11. 51326 0.02 3.52 MiB 0.013 1 1890 ['Trace'] 0.443 Reserved {} on local disk {}, having unreserved {}. 2025-10-09 13:02:20 12. 47677 0.018 3.23 MiB 0.012 2630 1889 ['Trace'] 0.42 Trying to reserve {} using storage policy from min volume index {} 2025-10-09 13:02:20 13. 46243 0.018 5.23 MiB 0.02 2642 1379 ['Trace'] 0.34 Renaming temporary part {} to {} with tid {}. 2025-10-09 13:02:20 14. 45771 0.018 491.68 KiB 0.002 1 1553 ['Trace'] 0 Aggregating 2025-10-09 13:02:20 15. 44238 0.017 3.52 MiB 0.013 1 1553 ['Trace'] 0 An entry for key={} found in cache: sum_of_sizes={}, median_size={} 2025-10-09 13:02:20 16. 42536 0.016 1.93 MiB 0.007 1 1385 ['Trace'] 0.207 filled checksums {} 2025-10-09 13:02:20 17. 39317 0.015 1.78 MiB 0.007 39317 514 ['Debug'] 0.996 Authenticating user '{}' from {} 2025-10-09 13:02:20 18. 39295 0.015 4.31 MiB 0.016 39295 514 ['Debug'] 0.996 {} Authenticated with global context as user {} 2025-10-09 13:02:20 19. 39243 0.015 3.37 MiB 0.013 39243 510 ['Debug'] 0.996 {} Logout, user_id: {} 2025-10-09 13:02:20 20. 38886 0.015 2.78 MiB 0.011 38886 357 ['Debug'] 1 Creating session context with user_id: {} 2025-10-09 13:02:20 21. 38269 0.015 2.94 MiB 0.011 1560 295 ['Trace'] 0.001 Reading {} ranges in{}order from part {}, approx. {} rows starting from {} 2025-10-09 13:02:20 22. 34665 0.013 1.58 MiB 0.006 1 376 ['Debug'] 0.183 Peak memory usage{}: {}. 2025-10-09 13:02:20 23. 28116 0.011 5.67 MiB 0.021 3 348 ['Trace'] 1 HTTP Request for {}. Method: {}, Address: {}, User-Agent: {}{}, Content Type: {}, Transfer Encoding: {}, X-Forwarded-For: {} 2025-10-09 13:02:20 24. 28107 0.011 19.00 MiB 0.072 2 348 ['Trace'] 1 Request URI: {} 2025-10-09 13:02:20 25. 27368 0.01 561.26 KiB 0.002 2 348 ['Debug'] 0.226 Done processing query 2025-10-09 13:02:20 26. 22312 0.009 2.56 MiB 0.01 1 2 ['Trace'] 1 Creating part at path {} 2025-10-09 13:02:20 27. 20245 0.008 596.66 KiB 0.002 1723 362 ['Debug'] 0.005 Key condition: {} 2025-10-09 13:02:20 28. 19905 0.008 874.73 KiB 0.003 1718 362 ['Trace'] 0.006 Filtering marks by primary and secondary keys 2025-10-09 13:02:20 29. 19638 0.008 2.18 MiB 0.008 1712 362 ['Debug'] 0.006 Selected {}/{} parts by partition key, {} parts by primary key, {}/{} marks by primary key, {} marks to read from {} ranges 2025-10-09 13:02:20 30. 19468 0.007 1.71 MiB 0.006 304 525 ['Trace'] 0.998 Insert entry {} to queue with type {} 2025-10-09 13:02:20 31. 19321 0.007 433.97 KiB 0.002 1 1396 ['Trace'] 0 Merging aggregated data 2025-10-09 13:02:20 32. 19248 0.007 1.76 MiB 0.007 1 98 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part 2025-10-09 13:02:20 33. 18994 0.007 1.46 MiB 0.006 576 1620 ['Trace'] 0.853 Part {} is not stored on zero-copy replicated disk, blobs can be removed 2025-10-09 13:02:20 34. 17859 0.007 585.65 KiB 0.002 2 307 ['Trace'] 1 TCP Request. Address: {} 2025-10-09 13:02:20 35. 17856 0.007 1.68 MiB 0.006 1 307 ['Debug'] 1 Connected {} version {}.{}.{}, revision: {}{}{}. 2025-10-09 13:02:20 36. 17782 0.007 468.86 KiB 0.002 1 298 ['Debug'] 1 Done processing connection. 2025-10-09 13:02:20 37. 17694 0.007 915.80 KiB 0.003 1479 351 ['Trace'] 0.006 Spreading mark ranges among streams (default reading) 2025-10-09 13:02:20 38. 17174 0.007 1.43 MiB 0.005 710 512 ['Trace'] 1 Scheduling next merge selecting task after {}ms, current attempt status: {} 2025-10-09 13:02:20 39. 16666 0.006 2.26 MiB 0.009 547 512 ['Trace'] 1 Checked {} partitions, found {} partitions with parts that may be merged: [{}] (max_total_size_to_merge={}, merge_with_ttl_allowed={}) 2025-10-09 13:02:20 40. 15792 0.006 400.97 KiB 0.001 304 525 ['Debug'] 0.998 Pulled {} entries to queue. 2025-10-09 13:02:20 41. 15792 0.006 909.90 KiB 0.003 304 525 ['Debug'] 0.998 Pulling {} entries to queue: {} - {} 2025-10-09 13:02:20 42. 12827 0.005 989.58 KiB 0.004 1 303 ['Trace'] 0 Query span trace_id for opentelemetry log: {} 2025-10-09 13:02:20 43. 12642 0.005 1.31 MiB 0.005 1 68 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part, column {} 2025-10-09 13:02:20 44. 11875 0.005 498.66 KiB 0.002 3565 263 ['Debug'] 0.012 Found {} non used tables in detached tables. 2025-10-09 13:02:20 45. 11875 0.005 707.40 KiB 0.003 3565 263 ['Debug'] 0.012 There are {} detached tables. Start searching non used tables. 2025-10-09 13:02:20 46. 8812 0.003 1.25 MiB 0.005 1 166 ['Trace'] 0.018 PREWHERE condition was split into {} steps: {} 2025-10-09 13:02:20 47. 8567 0.003 330.52 KiB 0.001 244 35 ['Debug'] 0.722 Committing part {} to zookeeper 2025-10-09 13:02:20 48. 8352 0.003 293.63 KiB 0.001 1 1000 ['Trace'] 0.008 Converting aggregated data to blocks 2025-10-09 13:02:20 49. 8318 0.003 882.61 KiB 0.003 1 997 ['Debug'] 0.006 Converted aggregated data to blocks. {} rows, {} in {} sec. ({:.3f} rows/sec., {}/sec.) 2025-10-09 13:02:20 50. 8267 0.003 300.75 KiB 0.001 18 18 ['Trace'] 1 Flushed system log up to offset {} 2025-10-09 13:02:20 51. 8267 0.003 482.31 KiB 0.002 18 18 ['Trace'] 1 Flushing system log, {} entries to flush up to offset {} 2025-10-09 13:02:20 52. 8259 0.003 309.52 KiB 0.001 241 32 ['Debug'] 0.748 Part {} committed to zookeeper 2025-10-09 13:02:20 53. 7505 0.003 381.57 KiB 0.001 662 608 ['Debug'] 0.908 Selected {} parts from {} to {} 2025-10-09 13:02:20 54. 7352 0.003 215.39 KiB 0.001 705 524 ['Debug'] 0.994 Updating strategy picker state 2025-10-09 13:02:20 55. 7301 0.003 206.77 KiB 0.001 1 1324 ['Debug'] 1 Stop worker in {} 2025-10-09 13:02:20 56. 7301 0.003 557.77 KiB 0.002 1 201 ['Debug'] 0.001 Schedule load job '{}' into {} 2025-10-09 13:02:20 57. 7301 0.003 536.38 KiB 0.002 1 1170 ['Debug'] 1 Execute load job '{}' in {} 2025-10-09 13:02:20 58. 7301 0.003 285.20 KiB 0.001 1 1369 ['Debug'] 0.5 Spawn loader worker #{} in {} 2025-10-09 13:02:20 59. 7301 0.003 507.85 KiB 0.002 1 1170 ['Debug'] 1 Finish load job '{}' with status {} 2025-10-09 13:02:20 60. 7300 0.003 678.89 KiB 0.003 1 201 ['Debug'] 0 Prioritize load job '{}': {} -> {} 2025-10-09 13:02:20 61. 7277 0.003 63.96 KiB 0 2 201 ['Trace'] 0.001 No tables 2025-10-09 13:02:20 62. 7250 0.003 240.72 KiB 0.001 1 1352 ['Debug'] 0.5 Change current priority: {} -> {} 2025-10-09 13:02:20 63. 7091 0.003 265.93 KiB 0.001 328 198 ['Debug'] 0.012 Reading approx. {} rows with {} streams 2025-10-09 13:02:20 64. 6966 0.003 728.70 KiB 0.003 158 33 ['Debug'] 1 Fetching part {} from {}:{} 2025-10-09 13:02:20 65. 6890 0.003 3.24 MiB 0.012 2 24 ['Error'] 0 Number of arguments for function {} doesn't match: passed {}, should be {} 2025-10-09 13:02:20 66. 6886 0.003 549.03 KiB 0.002 1 1342 ['Trace'] 0 Statistics updated for key={}: new sum_of_sizes={}, median_size={} 2025-10-09 13:02:20 67. 6872 0.003 854.51 KiB 0.003 10 512 ['Debug'] 1 Not executing log entry {} of type {} for part {} because merges and mutations are cancelled now. 2025-10-09 13:02:20 68. 6833 0.003 587.21 KiB 0.002 157 35 ['Trace'] 1 Trying to fetch with zero-copy replication, but disk is not provided, will try to select 2025-10-09 13:02:20 69. 6833 0.003 246.87 KiB 0.001 157 35 ['Trace'] 1 Checking disk {} with type {} 2025-10-09 13:02:20 70. 6375 0.002 1.24 MiB 0.005 1 1266 ['Information'] 1 Removing metadata {} of dropped table {} 2025-10-09 13:02:20 71. 6373 0.002 473.00 KiB 0.002 1 198 ['Debug'] 0 Waiting for table {} to be finally dropped 2025-10-09 13:02:20 72. 6373 0.002 734.39 KiB 0.003 1 198 ['Debug'] 0 Done waiting for the table {} to be dropped. The outcome: {} 2025-10-09 13:02:20 73. 6353 0.002 187.98 KiB 0.001 249 1285 ['Trace'] 0.01 Found (RIGHT) boundary mark: {} 2025-10-09 13:02:20 74. 6353 0.002 194.85 KiB 0.001 249 1285 ['Trace'] 0.01 Found {} range {}in {} steps 2025-10-09 13:02:20 75. 6353 0.002 436.62 KiB 0.002 249 1285 ['Trace'] 0.01 Running binary search on index range for part {} ({} marks) 2025-10-09 13:02:20 76. 6353 0.002 181.62 KiB 0.001 249 1285 ['Trace'] 0.01 Found (LEFT) boundary mark: {} 2025-10-09 13:02:20 77. 6193 0.002 135.25 KiB 0 143 85 ['Trace'] 1 Sending part {} 2025-10-09 13:02:20 78. 6189 0.002 119.02 KiB 0 155 36 ['Debug'] 1 Downloading files {} 2025-10-09 13:02:20 79. 6186 0.002 525.56 KiB 0.002 155 36 ['Trace'] 1 Disk for fetch is not provided, getting disk from reservation {} with type '{}' 2025-10-09 13:02:20 80. 6182 0.002 273.87 KiB 0.001 152 36 ['Debug'] 1 Downloading part {} onto disk {}. 2025-10-09 13:02:20 81. 6179 0.002 328.04 KiB 0.001 152 36 ['Debug'] 1 Download of part {} onto disk {} finished. 2025-10-09 13:02:20 82. 6178 0.002 638.62 KiB 0.002 155 33 ['Debug'] 1 Fetched part {} from {}:{}{} 2025-10-09 13:02:20 83. 6134 0.002 443.28 KiB 0.002 1 512 ['Information'] 1 Have {} tables in drop queue ({} of them are in use), will try drop {} tables 2025-10-09 13:02:20 84. 5998 0.002 702.35 KiB 0.003 2294 1398 ['Debug'] 0.974 Removing {} parts from filesystem (serially): Parts: [{}] 2025-10-09 13:02:20 85. 5765 0.002 1.09 MiB 0.004 1 278 ['Trace'] 0.001 {}Keys: {}, datatype: {}, kind: {}, strictness: {}, right header: {} 2025-10-09 13:02:20 86. 5629 0.002 192.27 KiB 0.001 1 101 ['Debug'] 0 Selected MergeAlgorithm: {} 2025-10-09 13:02:20 87. 5629 0.002 459.21 KiB 0.002 1 101 ['Debug'] 0 Merging {} parts: from {} to {} into {} with storage {} 2025-10-09 13:02:20 88. 5628 0.002 197.87 KiB 0.001 1 57 ['Trace'] 1 Keeper request. Address: {} 2025-10-09 13:02:20 89. 5614 0.002 727.71 KiB 0.003 1 101 ['Debug'] 0 Merge sorted {} rows, containing {} columns ({} merged, {} gathered) in {} sec., {} rows/sec., {}/sec. 2025-10-09 13:02:20 90. 5598 0.002 356.63 KiB 0.001 493 101 ['Trace'] 0 Merged {} parts: [{}, {}] -> {} 2025-10-09 13:02:20 91. 5349 0.002 376.31 KiB 0.001 1 562 ['Trace'] 0.822 Rolling back transaction {}{} 2025-10-09 13:02:20 92. 5249 0.002 379.54 KiB 0.001 373 892 ['Debug'] 0 Wrote block with ID '{}', {} rows{} 2025-10-09 13:02:20 93. 4994 0.002 363.09 KiB 0.001 1 180 ['Trace'] 0.012 The min valid primary key position for moving to the tail of PREWHERE is {} 2025-10-09 13:02:20 94. 4888 0.002 173.88 KiB 0.001 368 153 ['Debug'] 0.001 MinMax index condition: {} 2025-10-09 13:02:20 95. 4777 0.002 354.91 KiB 0.001 159 1063 ['Trace'] 0.031 Used generic exclusion search {}over index for part {} with {} steps 2025-10-09 13:02:20 96. 4760 0.002 152.89 KiB 0.001 20 80 ['Debug'] 0 Requested flush up to offset {} 2025-10-09 13:02:20 97. 4515 0.002 274.05 KiB 0.001 1 164 ['Trace'] 0.013 Condition {} moved to PREWHERE 2025-10-09 13:02:20 98. 4343 0.002 437.40 KiB 0.002 204 390 ['Trace'] 0.964 Found {} old parts to remove. Parts: [{}] 2025-10-09 13:02:20 99. 4343 0.002 441.64 KiB 0.002 204 390 ['Debug'] 0.964 Removing {} parts from memory: Parts: [{}] 2025-10-09 13:02:20 100. 4265 0.002 133.28 KiB 0 1 46 ['Debug'] 1 Receive four letter command {} 2025-10-09 13:02:20 2025-10-09 13:02:20 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string 2025-10-09 13:02:20 2025-10-09 13:02:20 2025-10-09 13:02:20 2025-10-09 13:02:20 Top messages without format string (fmt::runtime): 2025-10-09 13:02:20 2025-10-09 13:02:20 count pattern runtime_message line 2025-10-09 13:02:20 2025-10-09 13:02:20 1. 1406 IfthesignaturecheckfailedThiscou If the signature check failed. This could be because of a time skew. Attempting to adjust the signer. ('/AWSLogger.cpp',71) 2025-10-09 13:02:20 2. 26 CodeDBExceptionSyntaxerrorfailed Code: 62. DB::Exception: Syntax error: failed at position 55 ('by'): by LastName;. Max query size exceeded: 'by'. (SYNTAX_ERROR) (version 24.8.14.10503.altinitytest (altinity build)) (from [::1]:36544) (comment: 02366_kql_tabular.sql) (in query: Customers ('/executeQuery.cpp',221) 2025-10-09 13:02:20 3. 16 CodeDBExceptionEmptyqueryInscope Code: 62. DB::Exception: Empty query: In scope SELECT defaultValueOfTypeName(''). (SYNTAX_ERROR) (version 24.8.14.10503.altinitytest (altinity build)) (from [::1]:59150) (comment: 00534_functions_bad_arguments7.sh) (in query: SELECT defaultValueOfTypeName( ('/executeQuery.cpp',221) 2025-10-09 13:02:20 4. 12 CodeDBExceptionReceivedfromDBExc Code: 507. DB::Exception: Received from 127.0.0.2:9000. DB::Exception: Sharding key modulo(sub_key, 2) is not used. Stack trace: 2025-10-09 13:02:20 2025-10-09 13:02:20 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x000000003435ea14 2025-10-09 13:02:20 1. ('/executeQuery.cpp',221) 2025-10-09 13:02:20 5. 8 CodeCoordinationExceptionFaultin Code: 999. Coordination::Exception: Fault injection before operation. (KEEPER_EXCEPTION) (version 24.8.14.10503.altinitytest (altinity build)) (from [::1]:47266) (comment: 02456_keeper_retries_during_insert.sql) (in query: INSERT INTO keeper_retries_r1 SET ('/executeQuery.cpp',221) 2025-10-09 13:02:20 6. 8 CodeDBExceptionReceivedfromlocal Code: 242. DB::Exception: Received from localhost:9000. DB::Exception: Table is in readonly mode: replica_path=/tables/shard_1/data/replicas/read. Stack trace: 2025-10-09 13:02:20 2025-10-09 13:02:20 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const ('/executeQuery.cpp',221) 2025-10-09 13:02:20 7. 6 CodeDBExceptionboostwrapexceptbo Code: 1001. DB::Exception: boost::wrapexcept: Should start with 'LINESTRING'' in (). (STD_EXCEPTION) ('/TCPHandler.cpp',765) 2025-10-09 13:02:20 8. 6 stdexceptionCodetypeboostwrapexc std::exception. Code: 1001, type: boost::wrapexcept, e.what() = Should start with 'LINESTRING'' in () (version 24.8.14.10503.altinitytest (altinity build)) (from [::1]:59150) (comment: 00534_functions_bad_arguments7.sh) ('/executeQuery.cpp',221) 2025-10-09 13:02:20 9. 4 CodeDBExceptionTherequestsignatu Code: 499. DB::Exception: The request signature we calculated does not match the signature you provided. Check your key and signing method. (S3_ERROR) (version 24.8.14.10503.altinitytest (altinity build)) (from [::1]:33892) (comment: 02843_backup_use_same_ ('/executeQuery.cpp',221) 2025-10-09 13:02:20 10. 4 CodeDBExceptionExpectedargumento Code: 395. DB::Exception: Expected argument of data type real: while executing 'FUNCTION throwIf(_CAST(true_Bool, 'Bool'_String) :: 1, 'Expected argument of data type real'_String :: 2) -> throwIf(_CAST(true_Bool, 'Bool'_String), 'Expected argument of data ('/executeQuery.cpp',221) 2025-10-09 13:02:20 11. 2 CodeDBExceptionEmptyquerySYNTAXE Code: 62. DB::Exception: Empty query. (SYNTAX_ERROR) (version 24.8.14.10503.altinitytest (altinity build)) (from [::ffff:127.0.0.1]:38944) (in query: ), Stack trace (when copying this message, always include the lines below): 2025-10-09 13:02:20 2025-10-09 13:02:20 0. ./contrib/llvm-project/lib ('/executeQuery.cpp',221) 2025-10-09 13:02:20 12. 2 CodeDBExceptionSyntaxerrorcolumn Code: 62. DB::Exception: Syntax error (columns declaration list): failed at position 1 ('528.5899'): 528.5899. Expected one of: column declaration list, list of elements, column declaration, identifier. (SYNTAX_ERROR) (version 24.8.14.10503.altinitytest (a ('/executeQuery.cpp',221) 2025-10-09 13:02:20 13. 2 CodeDBExceptionFailedtogetobject Code: 499. DB::Exception: Failed to get object info: No response body.. HTTP response code: 404: while reading test: The table structure cannot be extracted from a CSV format file. You can specify the structure manually. (S3_ERROR) (version 24.8.14.10503.a ('/executeQuery.cpp',221) 2025-10-09 13:02:20 14. 2 CodeDBExceptionOutofmemoryalloca Code: 173. DB::Exception: Out of memory: allocation of size 80003648 failed: (in file/uri /var/lib/clickhouse/user_files/03147_parquet_memory_tracking.parquet): While executing ParquetBlockInputFormat: While executing File. (CANNOT_ALLOCATE_MEMORY) (versio ('/executeQuery.cpp',221) 2025-10-09 13:02:20 15. 2 CodeDBExceptionThereisnosubtypef Code: 386. DB::Exception: There is no subtype for types String, UInt8 because some of them are String/FixedString and some of them are not: In scope SELECT ['1', '2'] AS arr1, [1, 2] AS arr2, round(arrayJaccardIndex(arr1, arr2), 2). (NO_COMMON_TYPE) (versi ('/executeQuery.cpp',221) 2025-10-09 13:02:20 16. 1 stdexceptionCodetypeavroExceptio std::exception. Code: 1001, type: avro::Exception, e.what() = Cannot read compressed data, expected at least 4 bytes, got 0 (version 24.8.14.10503.altinitytest (altinity build)) (from [::1]:58212) (comment: 02373_heap_buffer_overflow_in_avro.sh) (in query: ('/executeQuery.cpp',221) 2025-10-09 13:02:20 17. 1 Failedtomakerequesttohttplocalho Failed to make request to: http://localhost:11111/test?list-type=2&max-keys=1&prefix=s3_plain%2Fstore%2F156%2F15693878-a537-4962-8dc3-8d990572fc38%2F: Poco::Exception. Code: 1000, e.code() = 0, No message received, Stack trace (when copying this message, a ('/PocoHTTPClient.cpp',575) 2025-10-09 13:02:20 18. 1 Forkedachildprocesstowatch Forked a child process to watch ('',0) 2025-10-09 13:02:20 19. 1 FailedtomakebackupShttplocalhost Failed to make backup S3('http://localhost:11111/test/backups/test_crhhwhfs/use_same_s3_credentials_for_base_backup_base_inc_3_bad', 'test', '[HIDDEN]'): Code: 499. DB::Exception: The request signature we calculated does not match the signature you provide ('/Exception.cpp',273) 2025-10-09 13:02:20 20. 1 ('/logTrace.cpp',50) 2025-10-09 13:02:20 21. 1 statemachinecommitindexprecommit state machine commit index 0, precommit index 0, last log index 0 ('/LoggerWrapper.h',43) 2025-10-09 13:02:20 22. 1 Electiontimeoutinitiateleaderele Election timeout, initiate leader election ('/LoggerWrapper.h',43) 2025-10-09 13:02:20 23. 1 bgappendentriesthreadinitiated bg append_entries thread initiated ('/LoggerWrapper.h',43) 2025-10-09 13:02:20 24. 1 CodeDBExceptionavroExceptionCann Code: 1001. DB::Exception: avro::Exception: Cannot read compressed data, expected at least 4 bytes, got 0. (STD_EXCEPTION), Stack trace (when copying this message, always include the lines below): 2025-10-09 13:02:20 2025-10-09 13:02:20 0. ./contrib/llvm-project/libcxx/include/exception:141: st ('/TCPHandler.cpp',765) 2025-10-09 13:02:20 25. 1 StartingClickHousealtinitytestre Starting ClickHouse 24.8.14.10503.altinitytest (revision: 4294967295, git hash: e905d7433e089be5ae0e2e1a62b31c75230e5cf9, build id: D34F2E679A0F56461827216EAF721A7442BABC81), PID 605 ('',0) 2025-10-09 13:02:20 26. 1 CodeDBExceptionstdruntimeerrorra Code: 1001. DB::Exception: std::runtime_error: ran out of bytes. (STD_EXCEPTION), Stack trace (when copying this message, always include the lines below): 2025-10-09 13:02:20 2025-10-09 13:02:20 0. ./contrib/llvm-project/libcxx/include/exception:141: std::runtime_error::runtime_error(char const ('/TCPHandler.cpp',765) 2025-10-09 13:02:20 27. 1 stdexceptionCodetypestdruntimeer std::exception. Code: 1001, type: std::runtime_error, e.what() = ran out of bytes (version 24.8.14.10503.altinitytest (altinity build)) (from [::1]:35104) (comment: 02688_aggregate_states.sql) (in query: SELECT '\x01\x01\x01'::AggregateFunction(groupBitmap ('/executeQuery.cpp',221) 2025-10-09 13:02:20 28. 1 snapshotidxlogtermcreatedcompact snapshot idx 100000 log_term 1 created, compact the log store if needed ('/LoggerWrapper.h',43) 2025-10-09 13:02:20 29. 1 newconfigurationlogidxprevlogidx new configuration: log idx 1, prev log idx 0 2025-10-09 13:02:20 peer 1, DC ID 0, localhost:9234, voting member, 1 2025-10-09 13:02:20 my id: 1, leader: 1, term: 1 ('/LoggerWrapper.h',43) 2025-10-09 13:02:26 30. 1 invalidelectiontimeoutupperbound invalid election timeout upper bound detected, adjusted to 0 ('/LoggerWrapper.h',43) 2025-10-09 13:02:26 2025-10-09 13:02:26 2025-10-09 13:02:26 2025-10-09 13:02:26 Top messages not matching their format strings: 2025-10-09 13:02:26 2025-10-09 13:02:26 message_format_string count() any_message 2025-10-09 13:02:26 2025-10-09 13:02:26 1. 1445 If the signature check failed. This could be because of a time skew. Attempting to adjust the signer. 2025-10-09 13:02:26 message_format_string count() any_message 2025-10-09 13:02:26 2025-10-09 13:02:26 2. {} is in use (by merge/mutation/INSERT) (consider increasing temporary_directories_lifetime setting) 42 /var/lib/clickhouse/store/da7/da7b6768-ebfc-4243-a256-65c9238bef9b/tmp_merge_202510_1_475_140/ is in use (by merge/mutation/INSERT) (consider increasing temporary_directories_lifetime setting) (skipped 1 similar messages) 2025-10-09 13:02:26 message_format_string count() any_message 2025-10-09 13:02:26 2025-10-09 13:02:26 3. Illegal UTF-8 sequence, while processing '{}' 12 Code: 36. DB::Exception: Illegal UTF-8 sequence, while processing '�': while executing 'FUNCTION stringJaccardIndexUTF8(materialize('hello'_String) :: 3, materialize('�'_String) :: 1) -> stringJaccardIndexUTF8(materialize('hello'_String), materialize('�'_String)) Float64 : 2'. (BAD_ARGUMENTS) (version 24.8.14.10503.altinitytest (altinity build)) (from [::1]:55686) (comment: 02884_string_distance_function.sql) (in query: SELECT stringJaccardIndexUTF8(materialize('hello'), materialize('\xC2\x01'));), Stack trace (when copying this message, always include the lines below): 2025-10-09 13:02:26 2025-10-09 13:02:26 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x000000003435ea14 2025-10-09 13:02:26 1. ./build_docker/./src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000001adb2269 2025-10-09 13:02:26 2. DB::Exception::Exception(PreformattedMessage&&, int) @ 0x000000000aa90445 2025-10-09 13:02:26 3. DB::Exception::Exception(int, FormatStringHelperImpl::type>, StringRef&&) @ 0x000000000cba6a34 2025-10-09 13:02:26 4. DB::parseUTF8String(char const*, unsigned long, std::function, std::function) @ 0x000000000cba59af 2025-10-09 13:02:26 5. DB::ByteJaccardIndexImpl::process(char const*, unsigned long, char const*, unsigned long) @ 0x000000000cbbf5fd 2025-10-09 13:02:26 6. DB::FunctionsStringSimilarity>, DB::NameJaccardIndexUTF8>::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000cbbdba1 2025-10-09 13:02:26 7. DB::FunctionToExecutableFunctionAdaptor::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000aacb135 2025-10-09 13:02:26 8. DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000cccee5b 2025-10-09 13:02:26 9. DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000ccd065c 2025-10-09 13:02:26 10. DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000ccd4030 2025-10-09 13:02:26 11. ./contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::ExpressionActions::execute(DB::Block&, unsigned long&, bool, bool) const @ 0x0000000028703c9d 2025-10-09 13:02:26 12. ./build_docker/./src/Processors/Transforms/ExpressionTransform.cpp:0: DB::ExpressionTransform::transform(DB::Chunk&) @ 0x000000002d9cdf8e 2025-10-09 13:02:26 13. ./contrib/llvm-project/libcxx/include/__utility/swap.h:35: DB::ISimpleTransform::transform(DB::Chunk&, DB::Chunk&) @ 0x000000001b49caff 2025-10-09 13:02:26 14. ./build_docker/./src/Processors/ISimpleTransform.cpp:99: DB::ISimpleTransform::work() @ 0x000000002d32ee39 2025-10-09 13:02:26 15. ./build_docker/./src/Processors/Executors/ExecutionThreadContext.cpp:0: DB::ExecutionThreadContext::executeTask() @ 0x000000002d36e5ce 2025-10-09 13:02:26 16. ./build_docker/./src/Processors/Executors/PipelineExecutor.cpp:273: DB::PipelineExecutor::executeStepImpl(unsigned long, std::atomic*) @ 0x000000002d3553b1 2025-10-09 13:02:26 17. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: DB::PipelineExecutor::executeImpl(unsigned long, bool) @ 0x000000002d353d5c 2025-10-09 13:02:26 18. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:274: DB::PipelineExecutor::execute(unsigned long, bool) @ 0x000000002d35385b 2025-10-09 13:02:26 19. ./build_docker/./src/Processors/Executors/PullingAsyncPipelineExecutor.cpp:94: void std::__function::__policy_invoker::__call_impl::ThreadFromGlobalPoolImpl(DB::PullingAsyncPipelineExecutor::pull(DB::Chunk&, unsigned long)::$_0&&)::'lambda'(), void ()>>(std::__function::__policy_storage const*) @ 0x000000002d3772d7 2025-10-09 13:02:26 20. ./contrib/llvm-project/libcxx/include/__functional/function.h:0: ? @ 0x000000001af7bc52 2025-10-09 13:02:26 21. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: void* std::__thread_proxy[abi:v15007]>, void (ThreadPoolImpl::ThreadFromThreadPool::*)(), ThreadPoolImpl::ThreadFromThreadPool*>>(void*) @ 0x000000001af88055 2025-10-09 13:02:26 22. asan_thread_start(void*) @ 0x000000000aa45059 2025-10-09 13:02:26 23. ? @ 0x00007f9653928ac3 2025-10-09 13:02:26 24. ? @ 0x00007f96539ba850 2025-10-09 13:02:26 2025-10-09 13:02:26 message_format_string count() any_message 2025-10-09 13:02:26 2025-10-09 13:02:26 4. Close WriteBufferFromAzureBlobStorage. {}. 6 Close WriteBufferFromAzureBlobStorage. ohhravsccsmjbyndvwdeakfmkspaxfxl. (LogSeriesLimiter: on interval from 2025-10-09 12:40:20 to 2025-10-09 12:41:17 accepted series 1 / 10 for the logger WriteBufferFromAzureBlobStorage) 2025-10-09 13:02:26 message_format_string count() any_message 2025-10-09 13:02:26 2025-10-09 13:02:26 5. Substitution '\{}' in replacement argument is invalid, regexp has only {} capturing groups 4 Code: 36. DB::Exception: Substitution '\1' in replacement argument is invalid, regexp has only 0 capturing groups. (BAD_ARGUMENTS) (version 24.8.14.10503.altinitytest (altinity build)) (from [::1]:32978) (comment: 02864_replace_regexp_string_fallback.sql) (in query: -- negative tests 2025-10-09 13:02:26 -- Even if the fallback is used, invalid substitutions must throw an exception. 2025-10-09 13:02:26 SELECT 'Hello' AS haystack, 'l' AS needle, '\\1' AS replacement, replaceRegexpOne(materialize(haystack), needle, replacement);), Stack trace (when copying this message, always include the lines below): 2025-10-09 13:02:26 2025-10-09 13:02:26 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x000000003435ea14 2025-10-09 13:02:26 1. ./build_docker/./src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000001adb2269 2025-10-09 13:02:26 2. DB::Exception::Exception(PreformattedMessage&&, int) @ 0x000000000aa90445 2025-10-09 13:02:26 3. DB::Exception::Exception(int, FormatStringHelperImpl::type, std::type_identity::type>, int&, int&&) @ 0x000000001803671a 2025-10-09 13:02:26 4. DB::ReplaceRegexpImpl::checkSubstitutions(std::basic_string_view>, int) @ 0x000000001803ea08 2025-10-09 13:02:26 5. DB::FunctionStringReplace, DB::(anonymous namespace)::NameReplaceRegexpOne>::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x0000000018038c8a 2025-10-09 13:02:26 6. DB::IFunction::executeImplDryRun(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000aa8e635 2025-10-09 13:02:26 7. DB::FunctionToExecutableFunctionAdaptor::executeDryRunImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000aacb1d5 2025-10-09 13:02:26 8. DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000cccecfb 2025-10-09 13:02:26 9. DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000ccd065c 2025-10-09 13:02:26 10. DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000ccd4030 2025-10-09 13:02:26 11. ./contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::ActionsDAG::evaluatePartialResult(std::unordered_map, std::equal_to, std::allocator>>&, std::vector> const&, unsigned long, bool) @ 0x000000002825fd68 2025-10-09 13:02:26 12. ./contrib/llvm-project/libcxx/include/vector:961: DB::ActionsDAG::updateHeader(DB::Block const&) const @ 0x000000002825d757 2025-10-09 13:02:26 13. ./build_docker/./src/Processors/Transforms/ExpressionTransform.cpp:10: DB::ExpressionTransform::transformHeader(DB::Block const&, DB::ActionsDAG const&) @ 0x000000002d9cd777 2025-10-09 13:02:26 14. ./build_docker/./src/Processors/QueryPlan/ExpressionStep.cpp:0: DB::ExpressionStep::ExpressionStep(DB::DataStream const&, DB::ActionsDAG) @ 0x000000002dd98859 2025-10-09 13:02:26 15. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:714: DB::(anonymous namespace)::addExpressionStep(DB::QueryPlan&, std::shared_ptr&, String const&, std::unordered_set, std::hash>, std::equal_to>, std::allocator>>&) @ 0x0000000029443753 2025-10-09 13:02:26 16. ./contrib/llvm-project/libcxx/include/string:1499: DB::Planner::buildPlanForQueryNode() @ 0x000000002943be40 2025-10-09 13:02:26 17. ./build_docker/./src/Planner/Planner.cpp:1254: DB::Planner::buildQueryPlanIfNeeded() @ 0x000000002942dbdb 2025-10-09 13:02:26 18. ./src/Planner/Planner.h:44: DB::InterpreterSelectQueryAnalyzer::getQueryPlan() @ 0x0000000029428f32 2025-10-09 13:02:26 19. ./build_docker/./src/Interpreters/executeQuery.cpp:1182: DB::executeQueryImpl(char const*, char const*, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum, DB::ReadBuffer*) @ 0x0000000029b3ed5e 2025-10-09 13:02:26 20. ./build_docker/./src/Interpreters/executeQuery.cpp:1397: DB::executeQuery(String const&, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum) @ 0x0000000029b39065 2025-10-09 13:02:26 21. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:612: DB::TCPHandler::runImpl() @ 0x000000002d18174c 2025-10-09 13:02:26 22. ./build_docker/./src/Server/TCPHandler.cpp:2517: DB::TCPHandler::run() @ 0x000000002d1b5580 2025-10-09 13:02:26 23. ./build_docker/./base/poco/Net/src/TCPServerConnection.cpp:57: Poco::Net::TCPServerConnection::start() @ 0x000000003453c1af 2025-10-09 13:02:26 24. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:48: Poco::Net::TCPServerDispatcher::run() @ 0x000000003453cd97 2025-10-09 13:02:26 25. ./build_docker/./base/poco/Foundation/src/ThreadPool.cpp:219: Poco::PooledThread::run() @ 0x000000003443f4ab 2025-10-09 13:02:26 26. ./base/poco/Foundation/include/Poco/SharedPtr.h:231: Poco::ThreadImpl::runnableEntry(void*) @ 0x0000000034439608 2025-10-09 13:02:26 27. asan_thread_start(void*) @ 0x000000000aa45059 2025-10-09 13:02:26 28. ? @ 0x00007f9653928ac3 2025-10-09 13:02:26 29. ? @ 0x00007f96539ba850 2025-10-09 13:02:26 2025-10-09 13:02:26 message_format_string count() any_message 2025-10-09 13:02:26 2025-10-09 13:02:26 6. (from {}{}{}){}{} {} (stage: {}) 3 (from [::1]:52236) (comment: 02686_bson3.sql) -- It correctly throws exception about incorrect data: 2025-10-09 13:02:26 SELECT * FROM format(BSONEachRow, 'WatchID Int64, JavaEnable Int16, Title String, GoodEvent Int16, EventTime DateTime, EventDate Date, CounterID Int32, ClientIP Int32, RegionID Int32, UserID Int64, CounterClass Int16, OS Int16, UserAgent Int16, URL String, Referer String, IsRefresh Int16, RefererCategoryID Int16, RefererRegionID Int32, URLCategoryID Int16, URLRegionID Int32, ResolutionWidth Int16, ResolutionHeight Int16, ResolutionDepth Int16, FlashMajor Int16, FlashMinor Int16, FlashMinor2 String, NetMajor Int16, NetMinor Int16, UserAgentMajor Int16, UserAgentMinor String, CookieEnable Int16, JavascriptEnable Int16, IsMobile Int16, MobilePhone Int16, MobilePhoneModel String, Params String, IPNetworkID Int32, TraficSourceID Int16, SearchEngineID Int16, SearchPhrase String, AdvEngineID Int16, IsArtifical Int16, WindowClientWidth Int16, WindowClientHeight Int16, ClientTimeZone Int16, ClientEventTime DateTime, SilverlightVersion1 Int16, SilverlightVersion2 Int16, SilverlightVersion3 Int32, SilverlightVersion4 Int16, PageCharset String, CodeVersion Int32, IsLink Int16, IsDownload Int16, IsNotBounce Int16, FUniqID Int64, OriginalURL String, HID Int32, IsOldCounter Int16, IsEvent Int16, IsParameter Int16, DontCountHits Int16, WithHash Int16, HitColor String, LocalEventTime DateTime, Age Int16, Sex Int16, Income Int16, Interests Int16, Robotness Int16, RemoteIP Int32, WindowName Int32, OpenerName Int32, HistoryLength Int16, BrowserLanguage String, BrowserCountry String, SocialNetwork String, SocialAction String, HTTPError Int16, SendTiming Int32, DNSTiming Int32, ConnectTiming Int32, ResponseStartTiming Int32, ResponseEndTiming Int32, FetchTiming Int32, SocialSourceNetworkID Int16, SocialSourcePage String, ParamPrice Int64, ParamOrderID String, ParamCurrency String, ParamCurrencyID Int16, OpenstatServiceName String, OpenstatCampaignID String, OpenstatAdID String, OpenstatSourceID String, UTMSource String, UTMMedium String, UTMCampaign String, UTMContent String, UTMTerm String, FromTag String, HasGCLID Int16, RefererHash Int64, URLHash Int64, CLID Int32', $$^WatchIDc*5/ !p~JavaEnableTitleGoodEventEventTime7�QEventDate>CounterIDClientIP�z�RegionIDGUserID� �:6�CounterClassOSUserAgentURLRefererIsRefreshRefererCategoryIDRefererRegionIDURLCategoryIDURLRegionIDResolutionWidthResolutionHeightResolutionDepthFlashMajorFlashMinorFlashMinor2NetMajorNetMinorUserAgentMajorUserAgentMinor�OCookieEnableJavascriptEnabl�sMobileMobilePhoneMobilePhoneModelParamsIPNetworkID�9TraficSourceIDSearchEngineIDSearchPhraseAdvEngineIDIsArtificalWindowClientWidthWindowClientHeightClientTimeZone�ClientEventTime�SilverlightVersion1SilverlightVersion2SilverlightVersion3SilverlightVersion4PageCharsetCodeVersionIsLinkIsDownloadIsNotBounceFUniqIDOriginalURLHIDIsOldCounterIsEventIsParameterDontCountHitsWithHashHitColor5LocalEventTime&�QAgeSexIncomeInterestsRobotnessRemoteIP^DI�WindowName�OpenerName�HistoryLength�BrowserLanguage�BrowserCountry� SocialNetworkSocialActionHTTPErrorSendTimingDNSTimingConnectTimingResponseStartTimingResponseEndTimingFetchTimingSocialSourceNetworkIDSocialSourcePageParamPriceParamOrderIDParamCurrencyNHParamCurrencyIDOpenstatServiceNameOpenstatCampaignIDOpenstatAdIDOpenstatSourceIDUTMSourceUTMMediumUTMCampaignUTMContentUTMTermFromTagHasGCLIDRefererHashX+�'�URLHash�|3�b.�CLID^WatchID�F�ӓ2qJavaEnableTitleGoodEventEventTimen$�QEventDate>CounterIDClientIP�z�RegionIDGUserID� �:6�CounterClassOSUserAgentURLRefererIsRefreshRefererCategoryIDRefererRegionIDURLCategoryIDURLRegionIDResolutionWidthResolutionHeightResolutionDepthFlashMajorFlashMinorFlashMinor2NetMajorNetMinorUserAgentMajorUserAgentMinor�OCookieEnableJavascriptEnableIsMobileMobilePhoneMobilePhoneModelParamsIPNetworkID�9TraficSourceIDSearchEngineIDSearchPhraseAdvEngineIDIsArtificalWindowClientWidthWindowClientHeightClientTimeZone�ClientEventTime�SilverlightVersion1SilverlightVersion2SilverlightVersion3SilverlightVersion4PageCharsetCodeVersionIsLinkIsDownloadIsNotBounceFUniqIDOriginalURLHIDIsOldCounterIsEventIsParameterDontCountHitsWithHashHitColor5LocalEventTimeǘ�QAgeSexIncomeInterestsRobotnessRemoteIP^DI�WindowName�OpenerName�HistoryLength�BrowserLanguage�BrowserCountry� SocialNetworkSocialActionHTTPErrorSendTimingDNSTimingConnectTimingResponseStartTimingResponseEndTimingFetchTimingSocialSourceNetworkIDSocialSourcePageP�amPriceParamOrderIDParamCurrencyNHParamCurrencyIDOpenstatServiceNameOpenstatCampaignIDOpenstatAdIDOpenstatSourceIDUTMSourceUTMMediumUTMCampaignUTMContentUTMTermFromTagHasGCLIDRefererHashX+�'�URLHash�|3�b.�CLID^WatchIDl!�|�@HJavaEnableTitleGoodEventEventTime�)�QEventDate>CounterIDClientIP�z�RegionIDGUserID� �:6�CounterClassOSUserAgentURLRefererIsRefreshRefererCategoryIDRefererRegionIDURLCategoryIDURLRegionIDResolutionWidthResolutionHeightResolutionDepthFlashMajorFlashMinorFlashMinor2NetMajorNetMinorUserAgentMajorUserAgentMinor�OCookieEnableJavascriptEnableIsMobileMobilePhoneMobilePhoneModelParamsIPNetworkID�9TraficSourceIDSearchEngineIDSearchPhraseAdvEngineIDIsArtificalWindowClientWidthWindowClientHeightClientTimeZone�ClientEventTime�SilverlightVersion1SilverlightVersion2SilverlightVersion3SilverlightVersion4PageCharsetCodeVersionIsLinkIsDownloadIsNotBounceFUniqIDOriginalURLHIDIsOldCounterIsEventIsParameterDontCountHitsWithHashHitColor5LocalEventTime}�QAgeSexIncomeInterestsRobotnessRemoteIP^DI�WindowName�OpenerName�HistoryLength�BrowserLanguage�BrowserCountry� SocialNetworkSocialActionHTTPErrorSendTimingDNSTimingConnectTimingResponseStartTimingResponseEndTimingFetchTimingSocialSourceNetworkIDSocialSourcePageParamPriceParamOrderIDParamCurrencyNHParamCurrencyIDOpenstatServiceNameOpenstatCampaignIDOpenstatAdIDOpenstatSourceIDUTMSourceUTMMediumUTMCampaignUTMContentUTMTermFromTagHasGCLIDRefererHashX+�'�URLHash�|3�b.�CLID^WatchID�ǐ=ЌWJavaEnableTitleGoodEventEventTime8*�QEventDate>CounterIDClientIP�z�RegionIDGUserID� �:6�CounterClassOSUserAgentURLRefererIsRefreshRefererCategoryIDRefererRegionIDURLCategoryIDURLRegionIDResolutionWidthResolutionHeightResolutionDepthFlashMajorFlashMinorFlashMinor2NetMajorNetMinorUserAgentMajorUserAgentMinor�OCookieEnableJavascriptEnableIsMobileMobilePhoneMobilePhoneModelParamsIPNetworkID�9TraficSourceIDSearchEngineIDSearchPhraseAdvEngineIDIsArtificalWindowClientWidthWindowClientHeightClientTimeZone�ClientEventTime�SilverlightVersion1SilverlightVersion2SilverlightVersion3SilverlightVersion4PageCharsetCodeVersionIsLinkIsDownloadIsNotBounceFUniqIDOriginalURLHIDIsOldCounterIsEventIsParameterDontCountHitsWithHashHitColor5LocalEventTimeݞ�QAgeSexIncomeInterestsRobotnessRemoteIP^DI�WindowName�OpenerName�HistoryLength�BrowserLanguage�BrowserCountry� SocialNetworkSocialActionHTTPErrorSendTimingDNSTimingConnectTimingResponseStartTimingResponseEndTimingFetchTimingSocialSourceNetworkIDSocialSourcePageParamPriceParamOrderIDParamCurrencyNHParamCurrencyIDOpenstatServiceNameOpenstatCampaignIDOpenstatAdIDOpenstatSourceIDUTMSourceUTMMediumUTMCampaignUTMContentUTMTermFromTagHasGCLIDRefererHashX+�'�URLHash�|3�b.�CLID�WatchID�E&LyJavaEnableTitleGoodEventEventTimeJ�QEventDate>CounterIDClientIP�I`RegionID'UserIDq�Jd8CounterClassOSUserAgentURL-http://holodilnik.ru/russia/05jul2013&model=0RefererIsRefreshRefererCategoryIDRefererRegionIDURLCateParams String, IPNetworkID Int32, TraficSourceID Int16, SearchEngineID Int16, SearchPhrase String, AdvEngineID Int16, IsArtifical Int16, WindowClientWidth Int16, WindowClientHeight Int16, ClientTimeZone Int16, ClientEventTime DateTime, SilverlightVersion1 Int16, SilverlightVersion2 Int16, SilverlightVersion3 Int32, SilverlightVersion4 Int16, PageCharset String, CodeVersion Int32, IsLink Int16, IsDownload Int16, IsNotBounce Int16, FUniqID Int64, OriginalURL String, HID Int32, IsOldCounter Int16, IsEvent Int16, IsParameter Int16, DontCountHits Int16, WithHash Int16, HitColor String, LocalEventTime DateTime, Age Int16, Sex Int16, Income Int16, Interests Int16, Robotness Int16, RemoteIP Int32, WindowName Int32, OpenerName Int32, HistoryLength Int16, BrowserLanguage String, BrowserCountry String, SocialNetwork String, SocialAction String, HTTPError Int16, SendTiming Int32, DNSTiming Int32, ConnectTiming Int32, ResponseStartTiming Int32, ResponseEndTiming Int32,�HistoryLength�BrowserLanguage�BrowserCountry� SocialNetworkSocialActionHTTPErrorSendTimingDNSTimingConnectTimingResponseStartTimingResponseEndTimingFetchTimingSocialSourceNetworkIDSocialSourcePageParamPriceParamOrderIDParamCurrencyNHParamCurrencyIDOpenstatServiceNameOpenstatCampaignIDOpenstatAdIDOpenstatSourceIDUTMSourceUTMMediumUTMCampaignUTMContentUTMTermFromTagHasGCLIDRefererHashX+�'�URLHash� 2025-10-09 13:02:28 o�eCLID�WatchID�k=�pJavaEnableTitleGoodEventEventTime� �QEventDate>CounterIDClien�Q9�HRegionIDGUserID �Ks}�CounterClassOSUserAgentURLHhttp://afisha.mail.ru/catalog/314/women.ru/ency=1&page3/?errovat-pinnikiRefererIsRefreshRefererCategoryIDRefererRegionIDURLCategoryID0=URLRegionID�ResolutionWidthResolutionHeightResolutionDepthFlashMajorFlashMinorFlashMinor2NetMajorNetMinorUserAgentMajorUserAgentMinorD�CookieEnableJavascriptEnableIsMobileMobilePhoneMobilePhoneModelParamsIPNetworkID�9TraficSourceIDSearchEngineIDSearchPhraseAdvEngineIDIsArtificalWindowClientWidthWindowClientHeightClientTimeZone�ClientEventTime�SilverlightVersion1SilverlightVersion2SilverlightVersion3SilverlightVersion4 PageCharsetCodeVersionIsLinkIsDownloadIsNotBounceFUniqID:�W�mOriginalURLHIDIsOldCounterIsEventIsParameterDontCountHitsWithHashHitColor5LocalEventTimeA�QAgeSexIncomeInterestsRobotnessRemoteIP^DI�WindowName�OpenerName�HistoryLength�BrowserLanguage�BrowserCountry� SocialNetworkSocialActionHTTPErrorSendTimingDNSTimingConnectTimingResponseStartTimingResponseEndTimingFetchTimingSocialSourceNetworkIDSocialSourcePageParamPriceParamOrderIDParamCurrencyNHParamCurrencyIDOpenstatServiceNameOpenstatCampaignIDOpenstatAdIDOpenstatSourceIDUTMSourceUTMMediumUTMCampaignUTMContentUTMTermFromTagHasGCLIDRefererHashX+�'�URLHash� �#�\CLID�Wa⋯ 2025-10-09 13:02:28 2025-10-09 13:02:28 2025-10-09 13:02:28 2025-10-09 13:02:28 Top short messages: 2025-10-09 13:02:28 2025-10-09 13:02:28 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-09 13:02:28 2025-10-09 13:02:28 1. 119 {} Server was built with address sanitizer. It will work slowly. 35 2025-10-09 13:02:28 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-09 13:02:28 2025-10-09 13:02:28 2. 19 Creating {}: {} Creating table test_8m8k5a20.test: CREATE TABLE IF NOT EXISTS test_8m8k5a20.test UUID '2896e191-cac2-4921-92fe-d84df54ea 124 2025-10-09 13:02:28 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-09 13:02:28 2025-10-09 13:02:28 3. 12 Froze {} parts Froze 1 parts -13 2025-10-09 13:02:28 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-09 13:02:28 2025-10-09 13:02:28 4. 6 Bad SSH public key provided Code: 706. DB::Exception: Bad SSH public key provided. (LIBSSH_ERROR) (version 24.8.14.10503.altinitytest (altinity buil 29 2025-10-09 13:02:28 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-09 13:02:28 2025-10-09 13:02:28 5. 4 Unknown data type family: {} Code: 50. DB::Exception: Unknown data type family: ab. (UNKNOWN_TYPE) (version 24.8.14.10503.altinitytest (altinity buil 29 2025-10-09 13:02:28 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-09 13:02:28 2025-10-09 13:02:28 6. 2 Unknown setting '{}' Code: 115. DB::Exception: Unknown setting 'xxx_yyy'. (UNKNOWN_SETTING) (version 24.8.14.10503.altinitytest (altinity bui 27 2025-10-09 13:02:28 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-09 13:02:28 2025-10-09 13:02:28 7. 2 Substitution {} is not set Code: 456. DB::Exception: Substitution `s` is not set. (UNKNOWN_QUERY_PARAMETER) (version 24.8.14.10503.altinitytest (al 29 2025-10-09 13:02:28 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-09 13:02:28 2025-10-09 13:02:28 8. 2 Unknown table engine {} Code: 56. DB::Exception: Unknown table engine s3. (UNKNOWN_STORAGE) (version 24.8.14.10503.altinitytest (altinity build) 24 2025-10-09 13:02:28 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-09 13:02:28 2025-10-09 13:02:28 9. 2 Invalid cache key hex: {} Code: 36. DB::Exception: Invalid cache key hex: kek. (BAD_ARGUMENTS) (version 24.8.14.10503.altinitytest (altinity build 27 2025-10-09 13:02:28 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2025-10-09 13:02:28 2025-10-09 13:02:28 10. 2 Table {} is not empty Code: 705. DB::Exception: Table tab2 is not empty. (TABLE_NOT_EMPTY) (version 24.8.14.10503.altinitytest (altinity build 25 2025-10-09 13:02:28 2025-10-09 13:02:28 2025-10-09 13:02:28 2025-10-09 13:02:28 Top messages by level: 2025-10-09 13:02:28 2025-10-09 13:02:28 (0.002634688406988616,'Number of arguments for function {} doesn\'t match: passed {}, should be {}') Error 2025-10-09 13:02:28 (0.00013230800998810757,'Not enabled four letter command {}') Warning 2025-10-09 13:02:28 (0.0024377559643762596,'Removing metadata {} of dropped table {}') Information 2025-10-09 13:02:28 (0.04878456355564393,'(from {}{}{}){}{} {} (stage: {})') Debug 2025-10-09 13:02:28 (0.08027845864992295,'is disk {} eligible for search: {}') Trace 2025-10-09 13:02:28 2025-10-09 13:02:28 + set -e + echo 'Files in current directory' + ls -la ./ Files in current directory total 129404 drwxr-xr-x 1 root root 4096 Oct 9 12:54 . drwxr-xr-x 1 root root 4096 Oct 9 12:54 .. -rw-rw-r-- 1 1000 1000 119 Oct 9 11:51 analyzer_tech_debt.txt -rw-rw-r-- 1 root root 2380 Jan 31 2025 attach_gdb.lib -rw-r--r-- 1 root root 1541 Oct 9 12:54 __azurite_db_blob_extent__.json -rw-r--r-- 1 root root 4241 Oct 9 12:42 __azurite_db_blob__.json -rw-r--r-- 1 root root 2061335 Oct 9 13:01 azurite_log lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin drwxr-xr-x 2 root root 4096 Oct 9 12:54 __blobstorage__ drwxr-xr-x 2 root root 4096 Apr 18 2022 boot -rw-rw-r-- 1 1000 1000 292 Oct 9 11:51 broken_tests.json drwxr-x--- 4 root root 4096 Oct 9 12:42 data drwxr-xr-x 14 root root 3840 Oct 9 11:54 dev -rwxr-xr-x 1 root root 0 Oct 9 11:54 .dockerenv drwxr-xr-x 1 root root 4096 Oct 9 11:54 etc drwxr-x--- 2 root root 4096 Oct 9 12:42 flags drwxr-x--- 2 root root 4096 Oct 9 12:42 format_schemas drwxr-xr-x 1 1000 1000 4096 Oct 9 11:55 hadoop-3.3.1 drwxr-xr-x 2 root root 4096 Apr 18 2022 home lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32 lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64 lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32 -rwxr-xr-x 1 root root 26927256 Jan 31 2025 mc drwxr-xr-x 2 root root 4096 Sep 11 2024 media drwxr-x--- 2 root root 4096 Oct 9 12:42 metadata drwxr-x--- 2 root root 4096 Oct 9 12:42 metadata_dropped -rwxr-xr-x 1 root root 103174296 Jan 31 2025 minio drwxr-xr-x 4 root root 4096 Oct 9 11:55 minio_data drwxr-xr-x 2 root root 4096 Sep 11 2024 mnt drwxr-xr-x 1 root root 4096 Jan 31 2025 opt -rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate drwxrwxr-x 2 1000 1000 4096 Oct 9 11:54 package_folder drwxr-x--- 2 root root 4096 Oct 9 12:45 preprocessed_configs dr-xr-xr-x 312 root root 0 Oct 9 11:54 proc -rwxrwxr-x 1 root root 9627 Jan 31 2025 process_functional_tests_result.py -rw-r--r-- 1 root root 29 Oct 9 12:08 queries_02352 -rw-r----- 1 root root 1 Oct 9 12:42 quotas.list -rw-rw-r-- 1 root root 837 Jan 31 2025 requirements.txt -rw-r----- 1 root root 1 Oct 9 12:42 roles.list drwx------ 1 root root 4096 Oct 9 12:59 root -rw-r----- 1 root root 1 Oct 9 12:42 row_policies.list drwxr-xr-x 1 root root 4096 Oct 9 11:54 run -rwxrwxr-x 1 root root 22124 Jan 31 2025 run.sh lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin -rw-r--r-- 1 root root 65777 Oct 9 12:48 server.log -rw-r----- 1 root root 1 Oct 9 12:42 settings_profiles.list -rwxrwxr-x 1 root root 10374 Jan 31 2025 setup_export_logs.sh -rwxrwxr-x 1 root root 360 Jan 31 2025 setup_hdfs_minicluster.sh -rwxrwxr-x 1 root root 3456 Jan 31 2025 setup_minio.sh drwxr-xr-x 2 root root 4096 Sep 11 2024 srv -rw-r----- 1 root root 65 Oct 9 12:45 status drwxr-x--- 4 root root 4096 Oct 9 12:42 store -rw-rw-r-- 1 root root 14015 Jan 31 2025 stress_tests.lib dr-xr-xr-x 13 root root 0 Oct 9 11:54 sys drwxrwxr-x 2 1000 1000 4096 Oct 9 11:55 test_output drwxrwxrwt 1 root root 4096 Oct 9 13:02 tmp drwxr-x--- 2 root root 4096 Oct 9 12:42 user_files -rw-r----- 1 root root 1 Oct 9 12:42 users.list drwxr-xr-x 1 root root 4096 Sep 11 2024 usr -rw-rw-r-- 1 root root 897 Jan 31 2025 utils.lib -rw-r----- 1 root root 36 Oct 9 12:42 uuid drwxr-xr-x 1 root root 4096 Sep 11 2024 var + echo 'Files in root directory' + ls -la / Files in root directory total 129404 drwxr-xr-x 1 root root 4096 Oct 9 12:54 . drwxr-xr-x 1 root root 4096 Oct 9 12:54 .. -rw-rw-r-- 1 1000 1000 119 Oct 9 11:51 analyzer_tech_debt.txt -rw-rw-r-- 1 root root 2380 Jan 31 2025 attach_gdb.lib -rw-r--r-- 1 root root 1541 Oct 9 12:54 __azurite_db_blob_extent__.json -rw-r--r-- 1 root root 4241 Oct 9 12:42 __azurite_db_blob__.json -rw-r--r-- 1 root root 2061335 Oct 9 13:01 azurite_log lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin drwxr-xr-x 2 root root 4096 Oct 9 12:54 __blobstorage__ drwxr-xr-x 2 root root 4096 Apr 18 2022 boot -rw-rw-r-- 1 1000 1000 292 Oct 9 11:51 broken_tests.json drwxr-x--- 4 root root 4096 Oct 9 12:42 data drwxr-xr-x 14 root root 3840 Oct 9 11:54 dev -rwxr-xr-x 1 root root 0 Oct 9 11:54 .dockerenv drwxr-xr-x 1 root root 4096 Oct 9 11:54 etc drwxr-x--- 2 root root 4096 Oct 9 12:42 flags drwxr-x--- 2 root root 4096 Oct 9 12:42 format_schemas drwxr-xr-x 1 1000 1000 4096 Oct 9 11:55 hadoop-3.3.1 drwxr-xr-x 2 root root 4096 Apr 18 2022 home lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32 lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64 lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32 -rwxr-xr-x 1 root root 26927256 Jan 31 2025 mc drwxr-xr-x 2 root root 4096 Sep 11 2024 media drwxr-x--- 2 root root 4096 Oct 9 12:42 metadata drwxr-x--- 2 root root 4096 Oct 9 12:42 metadata_dropped -rwxr-xr-x 1 root root 103174296 Jan 31 2025 minio drwxr-xr-x 4 root root 4096 Oct 9 11:55 minio_data drwxr-xr-x 2 root root 4096 Sep 11 2024 mnt drwxr-xr-x 1 root root 4096 Jan 31 2025 opt -rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate drwxrwxr-x 2 1000 1000 4096 Oct 9 11:54 package_folder drwxr-x--- 2 root root 4096 Oct 9 12:45 preprocessed_configs dr-xr-xr-x 312 root root 0 Oct 9 11:54 proc -rwxrwxr-x 1 root root 9627 Jan 31 2025 process_functional_tests_result.py -rw-r--r-- 1 root root 29 Oct 9 12:08 queries_02352 -rw-r----- 1 root root 1 Oct 9 12:42 quotas.list -rw-rw-r-- 1 root root 837 Jan 31 2025 requirements.txt -rw-r----- 1 root root 1 Oct 9 12:42 roles.list drwx------ 1 root root 4096 Oct 9 12:59 root -rw-r----- 1 root root 1 Oct 9 12:42 row_policies.list drwxr-xr-x 1 root root 4096 Oct 9 11:54 run -rwxrwxr-x 1 root root 22124 Jan 31 2025 run.sh lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin -rw-r--r-- 1 root root 65777 Oct 9 12:48 server.log -rw-r----- 1 root root 1 Oct 9 12:42 settings_profiles.list -rwxrwxr-x 1 root root 10374 Jan 31 2025 setup_export_logs.sh -rwxrwxr-x 1 root root 360 Jan 31 2025 setup_hdfs_minicluster.sh -rwxrwxr-x 1 root root 3456 Jan 31 2025 setup_minio.sh drwxr-xr-x 2 root root 4096 Sep 11 2024 srv -rw-r----- 1 root root 65 Oct 9 12:45 status drwxr-x--- 4 root root 4096 Oct 9 12:42 store -rw-rw-r-- 1 root root 14015 Jan 31 2025 stress_tests.lib dr-xr-xr-x 13 root root 0 Oct 9 11:54 sys drwxrwxr-x 2 1000 1000 4096 Oct 9 11:55 test_output drwxrwxrwt 1 root root 4096 Oct 9 13:02 tmp drwxr-x--- 2 root root 4096 Oct 9 12:42 user_files -rw-r----- 1 root root 1 Oct 9 12:42 users.list drwxr-xr-x 1 root root 4096 Sep 11 2024 usr -rw-rw-r-- 1 root root 897 Jan 31 2025 utils.lib -rw-r----- 1 root root 36 Oct 9 12:42 uuid drwxr-xr-x 1 root root 4096 Sep 11 2024 var + /process_functional_tests_result.py 2025-10-09 13:02:28,308 File /analyzer_tech_debt.txt with broken tests found 2025-10-09 13:02:28,308 File /broken_tests.json with broken tests found 2025-10-09 13:02:28,308 Broken tests in the list: 4 2025-10-09 13:02:28,308 Find files in result folder test_result.txt,run.log,minio.log,hdfs_minicluster.log 2025-10-09 13:02:28,328 Is flaky check: False 2025-10-09 13:02:28,328 Result parsed 2025-10-09 13:02:28,334 Result written + clickhouse-client -q 'system flush logs' Detach all logs replication + stop_logs_replication + echo 'Detach all logs replication' + tee /dev/stderr + clickhouse-client --query 'select database||'\''.'\''||table from system.tables where database = '\''system'\'' and (table like '\''%_sender'\'' or table like '\''%_watcher'\'')' + timeout --preserve-status --signal TERM --kill-after 5m 15m xargs -n1 -r -i clickhouse-client --query 'drop table {}' xargs: warning: options --max-args and --replace/-I/-i are mutually exclusive, ignoring previous --max-args value + failed_to_save_logs=0 + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.query_log into outfile '\''/test_output/query_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.zookeeper_log into outfile '\''/test_output/zookeeper_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.trace_log into outfile '\''/test_output/trace_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.transactions_info_log into outfile '\''/test_output/transactions_info_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.metric_log into outfile '\''/test_output/metric_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.blob_storage_log into outfile '\''/test_output/blob_storage_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.error_log into outfile '\''/test_output/error_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + sleep 1 + clickhouse-client -q 'SYSTEM FLUSH ASYNC INSERT QUEUE' + clickhouse-client -q 'SELECT log FROM minio_audit_logs ORDER BY event_time INTO OUTFILE '\''/test_output/minio_audit_logs.jsonl.zst'\'' FORMAT JSONEachRow' + clickhouse-client -q 'SELECT log FROM minio_server_logs ORDER BY event_time INTO OUTFILE '\''/test_output/minio_server_logs.jsonl.zst'\'' FORMAT JSONEachRow' + sudo clickhouse stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 605. The process with pid = 605 is running. Sent terminate signal to process with pid 605. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 605. The process with pid = 605 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 605. The process with pid = 605 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 605. The process with pid = 605 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 605. The process with pid = 605 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 605. The process with pid = 605 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 605. The process with pid = 605 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 605. The process with pid = 605 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 605. The process with pid = 605 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 605. The process with pid = 605 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 605. The process with pid = 605 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 605. The process with pid = 605 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 605. The process with pid = 605 does not exist. Server stopped + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + kill 1459 + rg -Fa '' /var/log/clickhouse-server/clickhouse-server.log API: SYSTEM.config Time: 16:02:55 UTC 10/09/2025 DeploymentID: c82d706d-e6b4-48c0-a1d0-74fabb6e2759 Error: unable to send webhook log entry to 'minio-http-audit-ch_audit_webhook' err 'http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString returned 'Post "http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString": dial tcp 127.0.0.1:8123: connect: connection refused', please check your endpoint configuration' (*fmt.wrapError) 4: internal/logger/logonce.go:64:logger.(*logOnceType).logOnceConsoleIf() 3: internal/logger/logonce.go:157:logger.LogOnceConsoleIf() 2: cmd/logging.go:132:cmd.configLogOnceConsoleIf() 1: internal/logger/target/http/http.go:416:http.(*Target).startQueueProcessor() + : + rg -A50 -Fa ============ /var/log/clickhouse-server/stderr.log + : + data_path_config=--path=/var/lib/clickhouse/ + [[ -n '' ]] + zstd --threads=0 + '[' 0 -ne 0 ']' + for trace_type in CPU Memory Real + clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q ' select arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack, count(*) AS samples from system.trace_log where trace_type = '\''CPU'\'' group by trace order by samples desc settings allow_introspection_functions = 1 format TabSeparated' + zstd --threads=0 + for trace_type in CPU Memory Real + clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q ' select arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack, count(*) AS samples from system.trace_log where trace_type = '\''Memory'\'' group by trace order by samples desc settings allow_introspection_functions = 1 format TabSeparated' + zstd --threads=0 + for trace_type in CPU Memory Real + clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q ' select arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack, count(*) AS samples from system.trace_log where trace_type = '\''Real'\'' group by trace order by samples desc settings allow_introspection_functions = 1 format TabSeparated' + zstd --threads=0 + check_logs_for_critical_errors + sed -n '/WARNING:.*anitizer/,/^$/p' /var/log/clickhouse-server/stderr.log + rg -Fav -e 'ASan doesn'\''t fully support makecontext/swapcontext functions' -e DB::Exception /test_output/tmp + echo -e 'No sanitizer asserts\tOK\t\N\t' + rm -f /test_output/tmp + rg -Fa ' Application: Child process was terminated by signal 9' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + echo -e 'No OOM messages in clickhouse-server.log\tOK\t\N\t' + rg -Fa 'Code: 49. DB::Exception: ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + echo -e 'No logical errors\tOK\t\N\t' + '[' -s /test_output/logical_errors.txt ']' + rm /test_output/logical_errors.txt + rg --text 'Code: 499.*The specified key does not exist' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + grep -v a.myext + echo -e 'No lost s3 keys\tOK\t\N\t' + rg -Fa 'it is lost forever' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + grep SharedMergeTreePartCheckThread + echo -e 'No SharedMergeTree lost forever in clickhouse-server.log\tOK\t\N\t' + '[' -s /test_output/no_such_key_errors.txt ']' + rm /test_output/no_such_key_errors.txt + rg -Fa '########################################' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + echo -e 'Not crashed\tOK\t\N\t' + rg -Fa ' ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + echo -e 'No fatal messages in clickhouse-server.log\tOK\t\N\t' + '[' -s /test_output/fatal_messages.txt ']' + rm /test_output/fatal_messages.txt + rg -Faz '########################################' /test_output/blob_storage_log.tsv.zst /test_output/check_status.tsv /test_output/clickhouse-server.log.zst /test_output/error_log.tsv.zst /test_output/hdfs_minicluster.log /test_output/metric_log.tsv.zst /test_output/minio_audit_logs.jsonl.zst /test_output/minio.log /test_output/minio_server_logs.jsonl.zst /test_output/query_log.tsv.zst /test_output/run.log /test_output/test_results.tsv /test_output/test_result.txt /test_output/trace-log-CPU-flamegraph.tsv.zst /test_output/trace-log-Memory-flamegraph.tsv.zst /test_output/trace-log-Real-flamegraph.tsv.zst /test_output/trace_log.tsv.zst /test_output/transactions_info_log.tsv.zst /test_output/zookeeper_log.tsv.zst + rg -Fa ' received signal ' /test_output/gdb.log /test_output/gdb.log: No such file or directory (os error 2) + dmesg -T + grep -q -F -e 'Out of memory: Killed process' -e 'oom_reaper: reaped process' -e oom-kill:constraint=CONSTRAINT_NONE /test_output/dmesg.log + echo -e 'No OOM in dmesg\tOK\t\N\t' + rm /var/log/clickhouse-server/clickhouse-server.log + mv /var/log/clickhouse-server/stderr.log /test_output/ + [[ -n '' ]] + tar -chf /test_output/coordination.tar /var/lib/clickhouse/coordination tar: Removing leading `/' from member names tar: Removing leading `/' from hard link targets + rm -rf /var/lib/clickhouse/data/system/asynchronous_insert_log/ /var/lib/clickhouse/data/system/asynchronous_metric_log/ /var/lib/clickhouse/data/system/backup_log/ /var/lib/clickhouse/data/system/blob_storage_log/ /var/lib/clickhouse/data/system/crash_log/ /var/lib/clickhouse/data/system/error_log/ /var/lib/clickhouse/data/system/filesystem_cache_log/ /var/lib/clickhouse/data/system/metric_log/ /var/lib/clickhouse/data/system/opentelemetry_span_log/ /var/lib/clickhouse/data/system/part_log/ /var/lib/clickhouse/data/system/processors_profile_log/ /var/lib/clickhouse/data/system/query_log/ /var/lib/clickhouse/data/system/query_thread_log/ /var/lib/clickhouse/data/system/query_views_log/ /var/lib/clickhouse/data/system/s3queue_log/ /var/lib/clickhouse/data/system/session_log/ /var/lib/clickhouse/data/system/text_log/ /var/lib/clickhouse/data/system/trace_log/ /var/lib/clickhouse/data/system/transactions_info_log/ /var/lib/clickhouse/data/system/zookeeper_log/ + tar -chf /test_output/store.tar /var/lib/clickhouse/store tar: Removing leading `/' from member names tar: Removing leading `/' from hard link targets + tar -chf /test_output/metadata.tar /var/lib/clickhouse/metadata/03147_db.sql /var/lib/clickhouse/metadata/default.sql /var/lib/clickhouse/metadata/empty_db_01036.sql /var/lib/clickhouse/metadata/information_schema.sql /var/lib/clickhouse/metadata/INFORMATION_SCHEMA.sql /var/lib/clickhouse/metadata/system.sql /var/lib/clickhouse/metadata/test_8t81rovy.sql /var/lib/clickhouse/metadata/test_cpdvfnrd.sql /var/lib/clickhouse/metadata/test_gg52j6ug_1.sql /var/lib/clickhouse/metadata/test.sql /var/lib/clickhouse/metadata/test_unnau5zd.sql tar: Removing leading `/' from member names tar: Removing leading `/' from hard link targets + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + collect_core_dumps + find . -type f -maxdepth 1 -name 'core.*' + read -r core